Transcription Factor

Accessions: 5und_A (3D-footprint 20241219)
Names: 11-zinc finger protein, CCCTC-binding factor, CTCF_HUMAN, CTCFL paralog, Transcriptional repressor CTCF
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P49711
Length: 171
Pfam Domains: 4-26 C2H2-type zinc finger
4-26 C2H2-type zinc-finger domain
19-40 Zinc-finger double domain
32-55 C2H2-type zinc-finger domain
32-54 C2H2-type zinc finger
32-54 Zinc finger, C2H2 type
47-71 Zinc-finger double domain
60-83 C2H2-type zinc finger
90-113 Zinc finger, C2H2 type
90-113 C2H2-type zinc finger
121-142 Zinc finger, C2H2 type
121-142 C2H2-type zinc finger
135-157 Zinc-finger double domain
Sequence:
(in bold interface residues)
1 EKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPY 60
61 ECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGK 120
121 KCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHT
Interface Residues: 4, 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 42, 43, 44, 45, 46, 48, 49, 57, 70, 71, 72, 73, 74, 76, 77, 81, 101, 102, 103, 104, 107, 110, 130, 131, 133, 134, 137, 143, 157, 159, 161, 162, 165, 169
3D-footprint Homologues: 2kmk_A, 1tf3_A, 7y3l_A, 7n5w_A, 1ubd_C, 7ysf_A, 8ssq_A, 7w1m_H, 6u9q_A, 8ssu_A, 1tf6_A, 2gli_A, 8h9h_G, 6e94_A, 2lt7_A, 2jpa_A, 8cuc_F, 5v3j_F, 7txc_E, 8gn3_A, 7y3m_I, 1yuj_A, 2drp_D
Binding Motifs: 5und_A cGCCCCCTGCTGg
5und_AB CCAGCAGGGGGCGcGcCCCCTGCTG
Binding Sites: 5und_C
5und_D
5und_E
5und_F
Publications: Hashimoto H, Wang D, Horton JR, Zhang X, Corces VG, Cheng X. Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA. Mol Cell 66:711-720 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.