Transcription Factor

Accessions: rn (FlyZincFinger 1.0 )
Names: CG42277
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 181
Pfam Domains: 6-28 Zinc finger, C2H2 type
6-24 C2H2-type zinc finger
20-46 Zinc-finger double domain
34-50 C2H2-type zinc finger
35-57 Zinc finger, C2H2 type
35-53 C2H2-type zinc finger
50-74 Zinc-finger double domain
63-83 Zinc-finger of C2H2 type
63-85 C2H2-type zinc finger
63-85 Zinc finger, C2H2 type
63-85 C2H2-type zinc finger
77-103 Zinc-finger double domain
91-113 Zinc finger, C2H2 type
98-115 C2H2-type zinc finger
121-140 C2H2-type zinc finger
151-174 C2H2-type zinc finger
152-174 Zinc finger, C2H2 type
152-174 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 GSGRKYQCKMCPQIFSSKADLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGI 60
61 KPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKP 120
121 FKCNSCYKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAERTDK 180
181 R
Interface Residues: 17, 19, 20, 22, 23, 24, 25, 26, 27, 29, 35, 45, 46, 47, 48, 49, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 103, 104, 105, 106, 107, 108, 109, 110, 131, 132, 133, 134, 135, 137, 138, 142, 163, 164, 165, 166, 169
3D-footprint Homologues: 6blw_A, 6u9q_A, 5yel_A, 8ssq_A, 7w1m_H, 5und_A, 5k5l_F, 8ssu_A, 5v3j_F, 6e94_A, 7ysf_A, 2lt7_A, 2jpa_A, 1ubd_C, 2i13_A, 2kmk_A, 3uk3_C, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5kkq_D, 5ei9_F, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 6wmi_A, 5k5i_A, 2gli_A, 1g2f_F, 4x9j_A, 8gn3_A, 8h9h_G, 4m9v_C, 7eyi_G, 7y3m_I, 6a57_A, 1tf3_A, 2drp_D, 5yj3_D, 1tf6_A, 6ml4_A, 1llm_D, 2wbs_A
Binding Motifs: rn_SANGER_10_FBgn0259172 mrrhsmAAAAAAAcrmdchrAdcrC
rn_SOLEXA_5_FBgn0259172 vmmcrcAAAAAAmmcmmmmmmmams
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.