Transcription Factor
Accessions: | rn (FlyZincFinger 1.0 ) |
Names: | CG42277 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 181 |
Pfam Domains: | 6-28 Zinc finger, C2H2 type 6-24 C2H2-type zinc finger 20-46 Zinc-finger double domain 34-50 C2H2-type zinc finger 35-57 Zinc finger, C2H2 type 35-53 C2H2-type zinc finger 50-74 Zinc-finger double domain 63-83 Zinc-finger of C2H2 type 63-85 C2H2-type zinc finger 63-85 Zinc finger, C2H2 type 63-85 C2H2-type zinc finger 77-103 Zinc-finger double domain 91-113 Zinc finger, C2H2 type 98-115 C2H2-type zinc finger 121-140 C2H2-type zinc finger 151-174 C2H2-type zinc finger 152-174 Zinc finger, C2H2 type 152-174 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 GSGRKYQCKMCPQIFSSKADLQLHTQIHMREAKPYKCTQCSKAFANSSYLSQHTRIHLGI 60 61 KPYRCEICQRKFTQLSHLQQHIRTHTGDKPYKCRHPGCQKAFSQLSNLQSHSRCHQTDKP 120 121 FKCNSCYKCFSDEPSLLEHIPKHKESKHLKTHICQYCGKSYTQETYLTKHMQKHAERTDK 180 181 R |
Interface Residues: | 17, 19, 20, 22, 23, 24, 25, 26, 27, 29, 35, 45, 46, 47, 48, 49, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 103, 104, 105, 106, 107, 108, 109, 110, 131, 132, 133, 134, 135, 137, 138, 142, 163, 164, 165, 166, 169 |
3D-footprint Homologues: | 6blw_A, 6u9q_A, 5yel_A, 8ssq_A, 7w1m_H, 5und_A, 5k5l_F, 8ssu_A, 5v3j_F, 6e94_A, 7ysf_A, 2lt7_A, 2jpa_A, 1ubd_C, 2i13_A, 2kmk_A, 3uk3_C, 6jnm_A, 8cuc_F, 7y3l_A, 7n5w_A, 5kkq_D, 5ei9_F, 1mey_C, 7txc_E, 5kl3_A, 1f2i_J, 6wmi_A, 5k5i_A, 2gli_A, 1g2f_F, 4x9j_A, 8gn3_A, 8h9h_G, 4m9v_C, 7eyi_G, 7y3m_I, 6a57_A, 1tf3_A, 2drp_D, 5yj3_D, 1tf6_A, 6ml4_A, 1llm_D, 2wbs_A |
Binding Motifs: | rn_SANGER_10_FBgn0259172 mrrhsmAAAAAAAcrmdchrAdcrC rn_SOLEXA_5_FBgn0259172 vmmcrcAAAAAAmmcmmmmmmmams |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.