Transcription Factor

Accessions: GSC2_DBD (HumanTF 1.0), GSC2_TF2 (HumanTF2 1.0)
Names: GSC-2, GSC-L, GSC2, GSC2_HUMAN, Homeobox protein goosecoid-2, Homeobox protein goosecoid-like
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: O15499
Notes: Ensembl ID: ENSG00000063515; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, Ensembl ID: ENSG00000063515; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013
Length: 120
Pfam Domains: 42-98 Homeobox domain
Sequence:
(in bold interface residues)
1 MAARLAWPLRLGPAVPLSLGAPAGGSGALPGAVGPGSQRRTRRHRTIFSEEQLQALEALF 60
61 VQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASASARLLPGVKKSPKGSC 120
Interface Residues: 40, 42, 43, 44, 45, 83, 84, 86, 87, 90, 91, 93, 94, 95
3D-footprint Homologues: 2lkx_A, 8ejp_B, 8pmf_A, 6m3d_C, 1zq3_P, 6es3_K, 7q3o_C, 2ld5_A, 2hdd_A, 9b8u_A, 4cyc_A, 8ik5_C, 2hos_A, 8osb_E, 8eml_B, 7xrc_C, 8g87_X, 6wig_A, 8bx1_A, 7psx_B
Binding Motifs: GSC2_DBD cyTAATCcsh
ETV2_GSC2_1 aCCGGAwrymmbkcmcTAATCcc
ETV2_GSC2_2 aCCGGAwryrsvcvmTAATCck
ETV2_GSC2_2_3 rcCGGAAryscmmcTAATcym
ETV2_GSC2_2_3_4 rsCGGAwrtrsgGATTA
ETV2_GSC2_2_3_4_5 rvCGGAwrtkrsggATTA
POU2F1_GSC2_1 / POU2F1_GSC2_2 mrgATTAwdyATkCawaww
TEAD4_GSC2 ggwATGtTAATCsg
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.