Transcription Factor
| Accessions: | GSC2_DBD (HumanTF 1.0), GSC2_TF2 (HumanTF2 1.0) |
| Names: | GSC-2, GSC-L, GSC2, GSC2_HUMAN, Homeobox protein goosecoid-2, Homeobox protein goosecoid-like |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Uniprot: | O15499 |
| Notes: | Ensembl ID: ENSG00000063515; DNA-binding domain sequence; TF family: homeodomain; Clone source: Gene synthesis, Ensembl ID: ENSG00000063515; Construct type: TF2(3xFLAG); TF family: Homeodomain; Clone source: Jolma et al. 2013 |
| Length: | 120 |
| Pfam Domains: | 42-98 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MAARLAWPLRLGPAVPLSLGAPAGGSGALPGAVGPGSQRRTRRHRTIFSEEQLQALEALF 60 61 VQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASASARLLPGVKKSPKGSC 120 |
| Interface Residues: | 17, 21, 40, 42, 43, 44, 45, 83, 84, 86, 87, 90, 91, 94, 95, 98 |
| 3D-footprint Homologues: | 1au7_A, 2lkx_A, 1mnm_C, 3d1n_M, 1fjl_B, 5zfz_A, 1ig7_A, 2h1k_B, 1puf_A, 6a8r_A, 3cmy_A, 1nk2_P, 1zq3_P, 6m3d_C, 3lnq_A, 1jgg_B, 7q3o_C, 1k61_B, 6es3_K, 2ld5_A, 1le8_B, 2hdd_A, 5jlw_D, 3rkq_B, 2r5y_A, 1puf_B, 4xrs_G, 2hos_A, 4cyc_A, 1b72_A, 5flv_I, 4j19_B, 3a01_E, 5hod_A, 1e3o_C, 7xrc_C, 2xsd_C, 1le8_A, 3l1p_A, 1o4x_A, 8g87_X, 5zjt_E, 7psx_B, 1du0_A, 4qtr_D |
| Binding Motifs: | GSC2_DBD cyTAATCcsh ETV2_GSC2_1 aCCGGAwrymmbkcmcTAATCcc ETV2_GSC2_2 aCCGGAwryrsvcvmTAATCck ETV2_GSC2_2_3 rcCGGAAryscmmcTAATcym ETV2_GSC2_2_3_4 rsCGGAwrtrsgGATTA ETV2_GSC2_2_3_4_5 rvCGGAwrtkrsggATTA POU2F1_GSC2_1 / POU2F1_GSC2_2 mrgATTAwdyATkCawaww TEAD4_GSC2 ggwATGtTAATCsg |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.