Transcription Factor
| Accessions: | 6chv_C (3D-footprint 20260701) |
| Names: | Antidote protein, Antitoxin HigA, HIGA_PROVU, Host inhibition of growth protein A |
| Organisms: | Proteus vulgaris |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q7A224 |
| Length: | 88 |
| Pfam Domains: | 14-63 Helix-turn-helix |
| Sequence: (in bold interface residues) | 1 FKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGST 60 61 PEFWLRLQSNYDLRQLENQIDTSGIVLY |
| Interface Residues: | 21, 22, 31, 32, 33, 34, 36, 37, 42, 43, 48 |
| 3D-footprint Homologues: | 1per_L, 6fix_D, 6chv_D, 7csw_B |
| Binding Motifs: | 6chv_AC TACAnnnnnTGTAnnA |
| Binding Sites: | 6chv_I 6chv_J |
| Publications: | Schureck MA, Meisner J, Hoffer ED, Wang D, Onuoha N, Ei Cho S, Lollar P 3rd, Dunham CM. Structural basis of transcriptional regulation by the HigA antitoxin. Mol Microbiol 111:1449-1462 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.