Transcription Factor

Accessions: 6chv_C (3D-footprint 20260701)
Names: Antidote protein, Antitoxin HigA, HIGA_PROVU, Host inhibition of growth protein A
Organisms: Proteus vulgaris
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q7A224
Length: 88
Pfam Domains: 14-63 Helix-turn-helix
Sequence:
(in bold interface residues)
1 FKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGST 60
61 PEFWLRLQSNYDLRQLENQIDTSGIVLY
Interface Residues: 21, 22, 31, 32, 33, 34, 36, 37, 42, 43, 48
3D-footprint Homologues: 1per_L, 6fix_D, 6chv_D, 7csw_B
Binding Motifs: 6chv_AC TACAnnnnnTGTAnnA
Binding Sites: 6chv_I
6chv_J
Publications: Schureck MA, Meisner J, Hoffer ED, Wang D, Onuoha N, Ei Cho S, Lollar P 3rd, Dunham CM. Structural basis of transcriptional regulation by the HigA antitoxin. Mol Microbiol 111:1449-1462 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.