Transcription Factor
| Accessions: | l(3)neo38 (FlyZincFinger 1.0 ), scrt (FlyZincFinger 1.0 ) |
| Names: | CG6930, CG1130 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 134 |
| Pfam Domains: | 15-37 C2H2-type zinc finger 43-65 C2H2-type zinc finger 43-65 Zinc finger, C2H2 type 57-82 Zinc-finger double domain 71-91 C2H2-type zinc finger 71-93 Zinc finger, C2H2 type 86-109 Zinc-finger double domain 100-121 C2H2-type zinc finger 100-121 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 GEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTR 60 61 HKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRS 120 121 HIARRVKSEVSAQN |
| Interface Residues: | 4, 25, 26, 27, 28, 29, 31, 32, 34, 35, 38, 43, 46, 50, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 64, 81, 82, 83, 84, 85, 86, 87, 88, 89, 109, 110, 111, 112, 113, 115, 116, 120 |
| 3D-footprint Homologues: | 5v3j_F, 5kkq_D, 6ml4_A, 8gn3_A, 5ei9_F, 7ysf_A, 2lt7_A, 6e94_A, 1tf6_A, 2jpa_A, 1ubd_C, 7w1m_H, 2kmk_A, 3gox_A, 1tf3_A, 7n5w_A, 6jnm_A, 2drp_D, 8ssq_A, 6blw_A, 5k5i_A, 6u9q_A, 5yel_A, 2gli_A, 2wbs_A, 4x9j_A, 1g2f_F, 5kl3_A, 7txc_E, 4m9v_C, 8h9h_G, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 1llm_D, 1f2i_J, 7y3m_I, 5yj3_D |
| Binding Motifs: | scrt_SANGER_2.5_FBgn0004880 aCCACCTGTTG scrt_SOLEXA_2.5_1_FBgn0004880 cCACCTGTTGmrc scrt_SOLEXA_2.5_2_FBgn0004880 rcCACCTGTTGma |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.