Transcription Factor

Accessions: l(3)neo38 (FlyZincFinger 1.0 ), scrt (FlyZincFinger 1.0 )
Names: CG6930, CG1130
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 134
Pfam Domains: 15-37 C2H2-type zinc finger
43-65 C2H2-type zinc finger
43-65 Zinc finger, C2H2 type
57-82 Zinc-finger double domain
71-91 C2H2-type zinc finger
71-93 Zinc finger, C2H2 type
86-109 Zinc-finger double domain
100-121 C2H2-type zinc finger
100-121 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 GEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTR 60
61 HKLSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRS 120
121 HIARRVKSEVSAQN
Interface Residues: 4, 25, 26, 27, 28, 29, 31, 32, 34, 35, 38, 43, 46, 50, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 64, 81, 82, 83, 84, 85, 86, 87, 88, 89, 109, 110, 111, 112, 113, 115, 116, 120
3D-footprint Homologues: 5v3j_F, 5kkq_D, 6ml4_A, 8gn3_A, 5ei9_F, 7ysf_A, 2lt7_A, 6e94_A, 1tf6_A, 2jpa_A, 1ubd_C, 7w1m_H, 2kmk_A, 3gox_A, 1tf3_A, 7n5w_A, 6jnm_A, 2drp_D, 8ssq_A, 6blw_A, 5k5i_A, 6u9q_A, 5yel_A, 2gli_A, 2wbs_A, 4x9j_A, 1g2f_F, 5kl3_A, 7txc_E, 4m9v_C, 8h9h_G, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 1llm_D, 1f2i_J, 7y3m_I, 5yj3_D
Binding Motifs: scrt_SANGER_2.5_FBgn0004880 aCCACCTGTTG
scrt_SOLEXA_2.5_1_FBgn0004880 cCACCTGTTGmrc
scrt_SOLEXA_2.5_2_FBgn0004880 rcCACCTGTTGma
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.