Transcription Factor

Accessions: T06258 (AthalianaCistrome v4_May2016), Q8GYP5 (JASPAR 2024)
Names: AT1G08810, MYB60, T06258;, AtMYB60, Myb domain protein 60, MYB60_ARATH, Transcription factor MYB60
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2024 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:MYB
Length: 280
Pfam Domains: 14-61 Myb-like DNA-binding domain
17-75 Myb-like DNA-binding domain
67-112 Myb-like DNA-binding domain
70-119 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MGRPPCCDKIGIKKGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNY 60
61 LRPGIKRGNFTPHEEGMIIHLQALLGNKWASIASYLPQRTDNDIKNYWNTHLKKKLNKSD 120
121 SDERSRSENIALQTSSTRNTINHRSTYASSTENISRLLEGWMRASPKSSTSTTFLEHKMQ 180
181 NRTNNFIDHHSDQFPYEQLQGSWEEGHSKGINGDDDQGIKNSENNNGDDVHHEDGDHEDD 240
241 DDHNATPPLTFIEKWLLEETSTTGGQMEEMSHLMELSNML
Interface Residues: 14, 49, 50, 51, 52, 54, 55, 58, 59, 60, 101, 102, 105, 106, 109, 110, 111
3D-footprint Homologues: 1vfc_A, 1w0t_A, 3osg_A, 2kdz_A, 3zqc_A, 5eyb_B, 6kks_A, 1mse_C, 7xur_A
Binding Motifs: M0563 hwwyyyCAACyACytyywy
MA1774.1 hwwyyyCAACyACytyywy
MA1774.2 yCAACyACyt
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.