Transcription Factor

Accessions: ELK4_DBD (HumanTF 1.0)
Names: ELK4, ELK4_HUMAN, ETS domain-containing protein Elk-4, SAP-1, Serum response factor accessory protein 1, SRF accessory protein 1
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P28324
Notes: Ensembl ID: ENSG00000158711; DNA-binding domain sequence; TF family: ETS; Clone source: Megaman
Length: 111
Pfam Domains: 5-86 Ets-domain
Sequence:
(in bold interface residues)
1 MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS 60
61 RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFS
Interface Residues: 57, 58, 60, 61, 62, 64, 65, 66, 69, 70, 79
3D-footprint Homologues: 8smh_F, 7jsa_J, 3jtg_A, 8smj_F, 1dux_F, 8ee9_F, 3zp5_A, 4mhg_A, 4uno_A, 2stt_A, 4l18_B, 1bc8_C, 4lg0_B, 1yo5_C, 4iri_A, 1awc_A, 8pvv_A
Binding Motifs: ELK4_DBD aCCGGAAryr
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.