Transcription Factor

						

			
Accessions: JUNB (HT-SELEX2 May2017)

			
Names: ENSG00000171223, JUNB
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 107
Pfam Domains:     26-89 bZIP transcription factor
    32-86 Basic region leucine zipper
Sequence: 
(in bold interface residues)		   1 EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV   60
  61 KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
Interface Residues: 34, 37, 38, 39, 41, 42, 45, 46
3D-footprint Homologues: 7x5e_F, 2wt7_A, 4eot_A, 7x5e_E, 1gd2_G, 2dgc_A, 5vpe_C, 5vpe_D, 5t01_B
Binding Motifs: JUNB_2 gATGACGTCAyc
JUNB_methyl_1 sATGAsTCAys
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.