Transcription Factor
Accessions: | JUNB (HT-SELEX2 May2017) |
Names: | ENSG00000171223, JUNB |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
Length: | 107 |
Pfam Domains: | 26-89 bZIP transcription factor 32-86 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV 60 61 KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF |
Interface Residues: | 34, 38, 39, 41, 42, 45, 46 |
3D-footprint Homologues: | 7x5e_E, 7x5e_F, 4eot_A, 2dgc_A |
Binding Motifs: | JUNB_2 gATGACGTCAyc JUNB_methyl_1 sATGAsTCAys |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.