Transcription Factor
| Accessions: | 3w6v_A (3D-footprint 20231221) |
| Names: | AdpA, AraC family transcriptional regulator, Q9S166_STRGR |
| Organisms: | Streptomyces griseus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9S166 |
| Length: | 111 |
| Pfam Domains: | 13-51 Bacterial regulatory helix-turn-helix proteins, AraC family 24-102 Helix-turn-helix domain 63-101 Bacterial regulatory helix-turn-helix proteins, AraC family |
| Sequence: (in bold interface residues) | 1 SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQ 60 61 RLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAYRAAYRARRPQG |
| Interface Residues: | 31, 32, 33, 34, 36, 37, 40, 58, 59, 61, 62, 81, 82, 83, 84, 86, 87, 91, 98, 109 |
| 3D-footprint Homologues: | 6ml4_A, 7vwz_G, 3w6v_A, 1xs9_A, 3jso_B, 1zgw_A, 6e94_A |
| Binding Motifs: | 3w6v_A cCGcCA |
| Binding Sites: | 3w6v_B 3w6v_C |
| Publications: | Yao M.D, Ohtsuka J, Nagata K, Miyazono K, Zhi Y, Ohnishi Y, Tanokura M. Complex structure of the DNA-binding domain of AdpA, the global transcription factor in Streptomyces griseus, and a target duplex DNA reveals the structural basis of its tolerant DNA sequence specificity. The Journal of biological chemistry 288:31019-29 (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.