Transcription Factor

Accessions: 3w6v_A (3D-footprint 20241219)
Names: AdpA, AraC family transcriptional regulator, Q9S166_STRGR
Organisms: Streptomyces griseus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9S166
Length: 111
Pfam Domains: 13-51 Bacterial regulatory helix-turn-helix proteins, AraC family
24-102 Helix-turn-helix domain
63-101 Bacterial regulatory helix-turn-helix proteins, AraC family
Sequence:
(in bold interface residues)
1 SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQWLITQRVLQAQ 60
61 RLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAYRAAYRARRPQG
Interface Residues: 31, 33, 34, 36, 37, 40, 82, 83, 84, 86, 87, 91, 98, 109
3D-footprint Homologues: 7vwz_G, 1xs9_A, 1zgw_A, 6e94_A
Binding Motifs: 3w6v_A cCGcCA
Binding Sites: 3w6v_B
3w6v_C
Publications: Yao M.D, Ohtsuka J, Nagata K, Miyazono K, Zhi Y, Ohnishi Y, Tanokura M. Complex structure of the DNA-binding domain of AdpA, the global transcription factor in Streptomyces griseus, and a target duplex DNA reveals the structural basis of its tolerant DNA sequence specificity. The Journal of biological chemistry 288:31019-29 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.