Transcription Factor
| Accessions: | 1kb4_B (3D-footprint 20231221) |
| Names: | 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR_HUMAN, Vitamin D3 Receptor |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P11473 |
| Length: | 99 |
| Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRL 60 61 KRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL |
| Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53, 82, 83 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 1kb4_AB GGncAnnnrGGnC 1kb4_B TGACC |
| Binding Sites: | 1kb4_C 1kb4_D |
| Publications: | Shaffer P.L, Gewirth D.T. Structural basis of VDR-DNA interactions on direct repeat response elements. The EMBO journal 21:2242-52 (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.