Transcription Factor

Accessions: NR2C1 (HT-SELEX2 May2017)
Names: ENSG00000120798, NR2C1
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 112
Pfam Domains: 19-87 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 LQLLTDNSPDQGPNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSK 60
61 DCIINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTE
Interface Residues: 28, 29, 31, 32, 38, 39, 41, 42, 45, 46, 70, 94, 96
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A
Binding Motifs: NR2C1_3 mrrGGTCAy
NR2C1_4 vrGgTcryGaMCyy
NR2C1_methyl_1 arrGGTCAh
NR2C1_methyl_2 rrGGTCryGACCyy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.