Transcription Factor

Accessions: 4aa6_F (3D-footprint 20231221)
Names: ER, ER-alpha, ESR1_HUMAN, Estradiol receptor, ESTROGEN RECEPTOR, Nuclear receptor subfamily 3 group A member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03372
Length: 69
Pfam Domains: 3-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKRKSCQACRLR 60
61 KCYEVGMMK
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 52
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B
Binding Motifs: 4aa6_EF AGTCAnnnTGACC
Binding Sites: 4aa6_G
4aa6_H
Publications: Schwabe J.W, Chapman L, Rhodes D. The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation. Structure (London, England : 1993) 3:201-13 (1995). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.