Transcription Factor

Accessions: 3kmp_A (3D-footprint 20250804)
Names: Dwarfin-A, Dwf-A, MAD homolog 1, Mad-related protein 1, mMad1, Mothers against decapentaplegic homolog 1, Mothers against DPP homolog 1, Mothers-against-DPP-related 1, SMAD 1, SMAD family member 1, SMAD1_MOUSE, SMAD1-MH1
Organisms: Mus musculus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P70340
Length: 124
Pfam Domains: 23-123 MH1 domain
Sequence:
(in bold interface residues)
1 FTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIP 60
61 RSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYK 120
121 RVES
Interface Residues: 64, 66, 68, 69, 72, 73
3D-footprint Homologues: 6fzs_A, 6h3r_A, 5nm9_A, 5od6_A, 5mey_A, 8k4l_B
Binding Motifs: 3kmp_A TGtCTa
3kmp_AB TGTCTAGaCT
Binding Sites: 3kmp_C
3kmp_D
Publications: BabuRajendran N, Palasingam P, Narasimhan K, Sun W, Prabhakar S, Jauch R, Kolatkar P.R. Structure of Smad1 MH1/DNA complex reveals distinctive rearrangements of BMP and TGF-beta effectors. Nucleic acids research 38:3477-88 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.