Transcription Factor
Accessions: | 6jrp_A (3D-footprint 20231221), 6jrp_D (3D-footprint 20231221), 6jrp_G (3D-footprint 20231221), 6jrp_J (3D-footprint 20231221) |
Names: | CIC_HUMAN, Protein capicua homolog |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q96RK0 |
Length: | 74 |
Pfam Domains: | 2-70 HMG (high mobility group) box 3-61 Domain of unknown function (DUF1898) |
Sequence: (in bold interface residues) | 1 HIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKE 60 61 AHFKAHPDWKWCNK |
Interface Residues: | 4, 7, 9, 10, 13, 17, 20, 28, 29, 30, 31, 33, 71, 73 |
3D-footprint Homologues: | 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 1hry_A, 3tq6_B, 1ckt_A, 7zie_A |
Binding Motifs: | 6jrp_AD AATGAAArtTTTCAT 6jrp_D AATGAAA 6jrp_GJ ATGAAAatTTTCAT |
Binding Sites: | 6jrp_E 6jrp_F 6jrp_H 6jrp_I |
Publications: | Lee H, Song JJ. The crystal structure of Capicua HMG-box domain complexed with the ETV5-DNA and its implications for Capicua-mediated cancers. FEBS J 286:4951-4963 (2019). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.