Transcription Factor

Accessions: 2a07_I (3D-footprint 20241219)
Names: CAG repeat protein 44, Forkhead box protein P2, FOXP2_HUMAN, Trinucleotide repeat-containing gene 10 protein
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O15409
Length: 81
Pfam Domains: 2-78 Fork head domain
Sequence:
(in bold interface residues)
1 VRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCF 60
61 VRVENVKGAVWTVDEVEYQKR
Interface Residues: 25, 44, 45, 47, 48, 49, 51, 52, 53, 55, 56, 67
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 8sro_B
Binding Motifs: 2a07_IK tTTGTT
Publications: Stroud J.C, Wu Y, Bates D.L, Han A, Nowick K, Paabo S, Tong H, Chen L. Structure of the forkhead domain of FOXP2 bound to DNA. Structure (London, England : 1993) 14:159-66 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.