Transcription Factor

Accessions: 3zkc_B (3D-footprint 20231221)
Names: HTH-TYPE TRANSCRIPTIONAL REGULATOR SINR, SINR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06533
Length: 63
Pfam Domains: 3-62 Helix-turn-helix domain
3-59 Helix-turn-helix domain
5-62 Cro/C1-type HTH DNA-binding domain
6-58 Helix-turn-helix
Sequence:
(in bold interface residues)
1 MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHT 60
61 LLD
Interface Residues: 6, 10, 17, 18, 27, 28, 29, 30, 32, 33, 36, 38, 39, 40, 45
3D-footprint Homologues: 1zzi_A, 3cro_R, 1per_L, 2r1j_L, 3zkc_A, 4z5h_A, 3dnv_B, 5k98_B, 3s8q_A, 6fix_D
Binding Motifs: 3zkc_AB GTTCtnnnnGnGAaC
Binding Sites: 3zkc_C
3zkc_D
Publications: Newman J.A, Rodrigues C, Lewis R.J. Molecular basis of the activity of SinR protein, the master regulator of biofilm formation in Bacillus subtilis. The Journal of biological chemistry 288:10766-78 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.