Transcription Factor

						

			
Accessions: 3zp5_A (3D-footprint 20231221)

			
Names: FEV_HUMAN, Fifth Ewing variant protein, PC12 ETS domain-containing transcription factor 1, PC12 ETS factor 1, Pet-1, PROTEIN FEV
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q99581
Length: 92
Pfam Domains:      3-85 Ets-domain
Sequence: 
(in bold interface residues)		   1 SGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSR   60
  61 ALRYYYDKNIMSKVHGKRYAYRFDFQGLAQAC
Interface Residues: 1, 56, 57, 59, 60, 61, 63, 64, 78
3D-footprint Homologues: 3zp5_A, 7jsa_J, 8ee9_F, 4mhg_A, 2stt_A, 4uno_A, 3jtg_A, 1dux_F, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A, 4iri_A, 1bc8_C, 4l18_B
Binding Motifs: 3zp5_A tCCG
Binding Sites: 3zp5_G
3zp5_C
			
Publications: Cooper C.D, Newman J.A, Aitkenhead H, Allerston C.K, Gileadi O. Structures of the Ets Domains of Transcription Factors ETV1, ETV4, ETV5 and FEV: Determinants of DNA Binding and Redox Regulation by Disulfide bond formation. The Journal of biological chemistry : (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.