Transcription Factor

Accessions: RARG_DBD (HumanTF 1.0), RARG (HT-SELEX2 May2017)
Names: E3VSK7_HUMAN, Fragment, NUP98/RARG fusion protein, RARG, ENSG00000172819
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: E3VSK7
Notes: Ensembl ID: ENSG00000172819; DNA-binding domain sequence; TF family: Nuclear_Receptor; Clone source: Megaman, TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Nuclear_receptor experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Nuclear_receptor experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 112
Pfam Domains: 20-88 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 SEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRD 60
61 KNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYE
Interface Residues: 29, 30, 32, 33, 39, 40, 41, 42, 43, 45, 46, 47, 50, 52, 56, 71, 75, 77, 79, 93, 95, 97, 100
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 5krb_G, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 8hbm_B, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 7xvn_C, 2han_B, 1kb2_B, 2a66_A, 8cef_H, 4yhx_A, 4tnt_B, 5cbz_E, 4hn5_B, 5e69_A, 8rm6_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: RARG_DBD_1 grGGTCAAAAGGTCAma
RARG_DBD_2 rAGGTCAhcyarAGGTCA
RARG_DBD_3 rRGGTCAmcarAGGTCA
RARG_3 raGGTCAAAAGKTCAm
RARG_4 rAGGTCATGACCTy
RARG_6 rrGGTCAcg
RARG_methyl_1 rrGGTCAaaRGGTCRw
RARG_methyl_2 rAGGTCrYGAMCTy
RARG_methyl_5 raGGTCRcg
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.