Transcription Factor
| Accessions: | A6NLW8 (JASPAR 2024) |
| Names: | DUXA_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | A6NLW8 |
| Length: | 204 |
| Pfam Domains: | 16-70 Homeobox domain 37-69 Homeobox KN domain 102-155 Homeobox domain 121-155 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQ 60 61 IWFQNRRARHGFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAF 120 121 MKNPYPGIDSREELAKEIGVPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGL 180 181 QGAEDTQNGTNFTSDSHFSGARTW |
| Interface Residues: | 16, 19, 61, 64, 65, 68, 75, 102, 103, 104, 105, 141, 142, 143, 144, 146, 147, 150, 151, 153, 154, 155 |
| 3D-footprint Homologues: | 5zfz_A, 6m3d_C, 1ig7_A, 8ejp_B, 6a8r_A, 3cmy_A, 1puf_A, 1fjl_B, 3d1n_M, 8pmf_A, 3lnq_A, 1nk2_P, 1zq3_P, 1jgg_B, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 1puf_B, 9b8u_A, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 5hod_A, 3rkq_B, 4xrs_G, 2hdd_A, 8osb_E, 1au7_A, 5jlw_D, 4cyc_A, 2r5y_A, 8eml_B, 5flv_I, 2hos_A, 1b72_A, 5gpc_B, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 8g87_X, 8bx1_A, 1du0_A, 4xrm_B, 1o4x_A, 1k61_B, 4qtr_D |
| Binding Motifs: | MA0884.1 ytrAyytAATCAr MA0884.2 yTrAyTwArTyAr |
| Publications: | Young JM, Whiddon JL, Yao Z, Kasinathan B, Snider L, Geng LN, Balog J, Tawil R, van der Maarel SM, Tapscott SJ. DUX4 binding to retroelements creates promoters that are active in FSHD muscle and testis. PLoS Genet : (2013). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.