Transcription Factor

Accessions: A6NLW8 (JASPAR 2024)
Names: DUXA_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: A6NLW8
Length: 204
Pfam Domains: 16-70 Homeobox domain
37-69 Homeobox KN domain
102-155 Homeobox domain
121-155 Homeobox KN domain
Sequence:
(in bold interface residues)
1 MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQ 60
61 IWFQNRRARHGFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAF 120
121 MKNPYPGIDSREELAKEIGVPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGL 180
181 QGAEDTQNGTNFTSDSHFSGARTW
Interface Residues: 16, 19, 61, 64, 65, 68, 75, 102, 103, 104, 105, 141, 142, 143, 144, 146, 147, 150, 151, 153, 154, 155
3D-footprint Homologues: 5zfz_A, 6m3d_C, 1ig7_A, 8ejp_B, 6a8r_A, 3cmy_A, 1puf_A, 1fjl_B, 3d1n_M, 8pmf_A, 3lnq_A, 1nk2_P, 1zq3_P, 1jgg_B, 2lkx_A, 2ld5_A, 7q3o_C, 6es3_K, 1puf_B, 9b8u_A, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 5hod_A, 3rkq_B, 4xrs_G, 2hdd_A, 8osb_E, 1au7_A, 5jlw_D, 4cyc_A, 2r5y_A, 8eml_B, 5flv_I, 2hos_A, 1b72_A, 5gpc_B, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 8g87_X, 8bx1_A, 1du0_A, 4xrm_B, 1o4x_A, 1k61_B, 4qtr_D
Binding Motifs: MA0884.1 ytrAyytAATCAr
MA0884.2 yTrAyTwArTyAr
Publications: Young JM, Whiddon JL, Yao Z, Kasinathan B, Snider L, Geng LN, Balog J, Tawil R, van der Maarel SM, Tapscott SJ. DUX4 binding to retroelements creates promoters that are active in FSHD muscle and testis. PLoS Genet : (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.