Transcription Factor

Accessions: 3g9o_A (3D-footprint 20231221), 3g9o_B (3D-footprint 20231221), 3g9p_A (3D-footprint 20231221), 3g9p_B (3D-footprint 20231221)
Names: GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06536
Length: 75
Pfam Domains: 3-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60
61 YRKCLQAGMNLEARK
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: 3g9o_A TGtnc
3g9o_AB GrrCAnnnTGnnc
3g9p_AB gnnCAnnnTGcTC
Binding Sites: 3g9o_C / 3g9p_C
3g9o_D / 3g9p_D
Publications: Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.