Transcription Factor
Accessions: | 3g9o_A (3D-footprint 20241219), 3g9o_B (3D-footprint 20241219), 3g9p_A (3D-footprint 20241219), 3g9p_B (3D-footprint 20241219) |
Names: | GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1 |
Organisms: | Rattus norvegicus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P06536 |
Length: | 75 |
Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR 60 61 YRKCLQAGMNLEARK |
Interface Residues: | 13, 15, 22, 25, 26, 29, 30, 54 |
3D-footprint Homologues: | 7wnh_D, 6l6q_B, 3g9m_B, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A |
Binding Motifs: | 3g9o_A TGtnc 3g9o_AB GrrCAnnnTGnnc 3g9p_AB gnnCAnnnTGcTC |
Binding Sites: | 3g9o_C / 3g9p_C 3g9o_D / 3g9p_D |
Publications: | Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.