Transcription Factor

Accessions: btd (FlyZincFinger 1.0 )
Names: CG12653
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 87
Pfam Domains: 2-26 C2H2-type zinc finger
18-43 Zinc-finger double domain
32-52 C2H2-type zinc finger
34-54 C2H2-type zinc finger
34-54 Zinc finger, C2H2 type
47-71 Zinc-finger double domain
60-82 C2H2-type zinc finger
60-82 Zinc finger, C2H2 type
60-82 C2H2-type zinc finger
60-80 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 QHICHIPGCERLYGKASHLKTHLRWHTGERPFLCLTCGKRFSRSDELQRHGRTHTNYRPY 60
61 ACPICSKKFSRSDHLSKHKKTHFKDKK
Interface Residues: 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 39, 42, 43, 44, 45, 46, 48, 49, 50, 70, 71, 72, 73, 74, 75, 76, 77, 78
3D-footprint Homologues: 6ml4_A, 7n5w_A, 1tf3_A, 6jnm_A, 5k5l_F, 8ssu_A, 1ubd_C, 5v3j_F, 4x9j_A, 8gn3_A, 1mey_C, 6blw_A, 5kkq_D, 6u9q_A, 5ei9_F, 2kmk_A, 5kl3_A, 2gli_A, 7ysf_A, 1g2f_F, 6wmi_A, 8ssq_A, 1tf6_A, 7w1m_H, 5und_A, 2i13_A, 7eyi_G, 8h9h_G, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 5k5i_A, 3g00_B, 7y3l_A, 3uk3_C, 8cuc_F, 2wbs_A, 2drp_D, 1f2i_J, 5yel_A, 7txc_E, 1llm_D, 4m9v_C, 5yj3_D
Binding Motifs: btd_NAR_FBgn0000233 argGGGCGKr
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.