Transcription Factor
| Accessions: | 1an2_A (3D-footprint 20231221) |
| Names: | bHLHd4, Class D basic helix-loop-helix protein 4, MAX_HUMAN, Myc-associated factor X, Protein max, TRANSCRIPTION FACTOR MAX (TF MAX) |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P61244 |
| Length: | 86 |
| Pfam Domains: | 3-53 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTH 60 61 QQDIDDLKRQNALLEQQVRALEKARS |
| Interface Residues: | 4, 6, 7, 8, 10, 11, 14, 15, 19, 39 |
| 3D-footprint Homologues: | 1a0a_B, 7z5k_B, 1an4_A, 7ssa_L, 5i50_B, 1am9_A, 8osl_O, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 7f2f_B, 5eyo_A, 7xq5_A, 5v0l_A, 4h10_A, 7rcu_E, 5gnj_I, 6g1l_A, 4h10_B |
| Binding Motifs: | 1an2_A CGTg |
| Binding Sites: | 1an2_B |
| Publications: | Ferre-D'Amare A. E., Prendergast G. C., Ziff E. B., Burley S. K. Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain. Nature 363:38-45 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.