Transcription Factor

Accessions: 6l6l_B (3D-footprint 20241219)
Names: Immediate-early response protein NOT, NR4A2_HUMAN, Nuclear receptor related 1, Nuclear receptor subfamily 4 group A member 2, Orphan nuclear receptor NURR1, Transcriptionally-inducible nuclear receptor
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P43354
Length: 84
Pfam Domains: 1-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ 60
61 KCLAVGMVKEVVRTDSLKGRRGRL
Interface Residues: 11, 13, 20, 23, 24, 27, 28, 52, 78, 81, 83
3D-footprint Homologues: 6l6q_B, 7wnh_D, 3g9m_B, 2ff0_A, 7xv6_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 3g6t_A, 8rm6_A, 7prw_B, 5cbx_B, 5cbz_E
Binding Motifs: 6l6l_AB AGGnCAnnnnnTGACCnA
Binding Sites: 6l6l_C
6l6l_D
Publications: Jiang L, Dai S, Li J, Liang X, Qu L, Chen X, Guo M, Chen Z, Chen L, Wei H, Chen Y. Structural basis of binding of homodimers of the nuclear receptor NR4A2 to selective Nur-responsive DNA elements. J Biol Chem 294:19795-19803 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.