Transcription Factor

Accessions: Q3C1V8 (JASPAR 2024)
Names: BSH_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q3C1V8
Length: 233
Pfam Domains: 111-167 Homeobox domain
Sequence:
(in bold interface residues)
1 MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMP 60
61 TPTLLAPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDS 120
121 QLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAPD 180
181 GPESPEGSPRGSEAATAAEARLSLPAGPFVLTEPEDEVDIGDEGELGSGPHVL
Interface Residues: 35, 110, 111, 112, 113, 114, 152, 153, 155, 156, 159, 160, 162, 163, 164, 167
3D-footprint Homologues: 5nw5_B, 4j19_B, 1fjl_B, 8ejp_B, 1ig7_A, 6a8r_A, 3cmy_A, 1puf_A, 3d1n_M, 8pmf_A, 5zfz_A, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 2ld5_A, 7q3o_C, 6es3_K, 9b8u_A, 5zjt_E, 3a01_E, 8ik5_C, 7psx_B, 1b72_A, 5jlw_D, 3rkq_B, 4xrs_G, 2hdd_A, 8osb_E, 4cyc_A, 2r5y_A, 8eml_B, 5flv_I, 2hos_A, 6m3d_C, 1au7_A, 5hod_A, 1le8_A, 7xrc_C, 1e3o_C, 2xsd_C, 8bx1_A, 4qtr_D, 1o4x_A, 1le8_B, 1du0_A, 1mnm_C, 1puf_B, 8g87_X, 1k61_B
Binding Motifs: MA0876.1 symATTAv
MA0876.2 ymATTA
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.