Transcription Factor
| Accessions: | 4oor_F (3D-footprint 20231221), 4ov7_F (3D-footprint 20231221) |
| Names: | Ancestral Steroid Receptor 2 DNA binding domain, Ancestral Steroid Receptor 2 DBD helix mutant |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 70 |
| Pfam Domains: | 3-69 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 QKVCLICGDEASGCHYGVLTCGSCKVFFKRAVEGHNYLCAGRNDCIIDKIRRKNCPACRL 60 61 RKCLQAGMTL |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 53 |
| 3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | 4oor_EF GnaCAnnnTGtnnA 4ov7_EF TnnnCAnnnTGTnC |
| Binding Sites: | 4oor_K / 4ov7_K 4oor_L / 4ov7_L |
| Publications: | McKeown A.N, Bridgham J.T, Anderson D.W, Murphy M.N, Ortlund E.A, Thornton J.W. Evolution of DNA specificity in a transcription factor family produced a new gene regulatory module. Cell 159:58-68 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.