Transcription Factor
Accessions: | 5ze0_N (3D-footprint 20241219) |
Names: | High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1 A-B box, HMGB1_MOUSE |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P63158 |
Length: | 118 |
Pfam Domains: | 1-63 Domain of unknown function (DUF1898) 4-64 HMG (high mobility group) box 64-118 HMG (high mobility group) box 64-117 Domain of unknown function (DUF1898) |
Sequence: (in bold interface residues) | 1 RGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAKEKGKFEDMAKADKARYE 60 61 REMKRPPSAFFLFCSEYRPKIKGEIGDVAKKLGEMWNNTDDKQPYEKKAAKLKEKYEK |
Interface Residues: | 65, 68, 70, 71, 74, 78, 85, 89 |
3D-footprint Homologues: | 2gzk_A, 7m5w_A |
Binding Motifs: | 5ze0_N CTnnnnnnnnacTT |
Binding Sites: | 5ze0_G 5ze0_M |
Publications: | Kim MS, Chuenchor W, Chen X, Cui Y, Zhang X, Zhou ZH, Gellert M, Yang W. Cracking the DNA Code for V(D)J Recombination. Mol Cell 70:358-370 (2018). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.