Transcription Factor
| Accessions: | Q15672 (JASPAR 2024) |
| Names: | bHLHa38, Class A basic helix-loop-helix protein 38, H-twist, Twist-related protein 1, TWST1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 202 |
| Pfam Domains: | 109-159 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV 60 61 GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR 120 121 TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH 180 181 ERLSYAFSVWRMEGAWSMSASH |
| Interface Residues: | 110, 113, 114, 116, 117, 118, 120, 121, 145 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 5i50_B, 6od3_F, 5eyo_A, 2ql2_D, 2ypa_B, 2ql2_A, 5gnj_I, 7ssa_L |
| Binding Motifs: | MA1123.1 awwCCAGATGTby MA1123.2 awwCCAGATGtbt MA1123.3 CCAGATGt |
| Binding Sites: | MA1123.3.5 MA1123.3.11 / MA1123.3.14 / MA1123.3.3 / MA1123.3.7 / MA1123.3.8 MA1123.1.1 MA1123.1.10 / MA1123.2.11 MA1123.1.11 / MA1123.2.12 MA1123.1.12 / MA1123.2.13 MA1123.1.13 / MA1123.2.14 MA1123.1.14 / MA1123.2.15 MA1123.1.15 / MA1123.2.16 MA1123.1.16 / MA1123.2.17 MA1123.1.17 / MA1123.2.18 MA1123.1.18 / MA1123.2.20 MA1123.1.19 MA1123.1.2 / MA1123.2.1 / MA1123.2.3 MA1123.1.20 MA1123.1.3 / MA1123.2.3 / MA1123.2.7 MA1123.1.4 / MA1123.2.4 / MA1123.2.9 MA1123.1.5 / MA1123.2.11 / MA1123.2.5 MA1123.1.6 / MA1123.2.14 / MA1123.2.6 MA1123.1.7 / MA1123.2.15 / MA1123.2.7 MA1123.1.8 / MA1123.2.16 / MA1123.2.8 MA1123.1.9 / MA1123.2.10 / MA1123.2.18 MA1123.2.1 MA1123.2.10 MA1123.2.12 MA1123.2.13 MA1123.2.17 / MA1123.2.9 MA1123.2.19 MA1123.2.2 MA1123.2.20 MA1123.2.4 MA1123.2.5 MA1123.2.6 MA1123.2.8 MA1123.2.19 MA1123.2.2 MA1123.3.1 / MA1123.3.20 / MA1123.3.6 MA1123.3.10 / MA1123.3.17 MA1123.3.12 / MA1123.3.15 / MA1123.3.4 / MA1123.3.9 MA1123.3.13 MA1123.3.16 MA1123.3.18 MA1123.3.19 MA1123.3.2 |
| Publications: | Chang AT, Liu Y, Ayyanathan K, Benner C, Jiang Y, Prokop JW, Paz H, Wang D, Li HR, Fu XD, Rauscher FJ 3rd, Yang J. An evolutionarily conserved DNA architecture determines target specificity of the TWIST family bHLH transcription factors. Genes Dev 29:603-16 (2015). [Pubmed] Shukunami C, Takimoto A, Nishizaki Y, Yoshimoto Y, Tanaka S, Miura S, Watanabe H, Sakuma T, Yamamoto T, Kondoh G, Hiraki Y. Scleraxis is a transcriptional activator that regulates the expression of Tenomodulin, a marker of mature tenocytes and ligamentocytes. Sci Rep 8:3155 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.