Transcription Factor

Accessions: 6fbq_A (3D-footprint 20250804)
Names: Nuclear receptor subfamily 2 group B member 1, Retinoic acid receptor RXR-alpha, Retinoid X receptor alpha, RXRA_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P19793
Length: 80
Pfam Domains: 5-73 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 FTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQY 60
61 CRYQKCLAMGMKREAVQEER
Interface Residues: 14, 15, 17, 18, 24, 25, 27, 28, 31, 32, 56, 78, 80
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A
Binding Motifs: 6fbq_A TGGGTCAnnG
6fbq_AB TGGGTCAnGGTTCA
Binding Sites: 6fbq_C
6fbq_D
Publications: Osz J, McEwen AG, Wolf J, Poussin-Courmontagne P, Peluso-Iltis C, Chebaro Y, Kieffer B, Rochel N. Modulation of RXR-DNA complex assembly by DNA context. Mol Cell Endocrinol : (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.