Transcription Factor
Accessions: | 4cn3_C (3D-footprint 20231221) |
Names: | Nuclear receptor subfamily 2 group B member 1, RETINOIC ACID RECEPTOR RXR-ALPHA, Retinoid X receptor alpha, RXRA_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P19793 |
Length: | 84 |
Pfam Domains: | 9-77 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 GSHMFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRN 60 61 RCQYCRYQKCLAMGMKREAVQEER |
Interface Residues: | 18, 19, 21, 22, 28, 29, 31, 32, 35, 36, 60, 82, 84 |
3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
Binding Motifs: | 4cn3_BC TGACCTnTGAAC 4cn3_C TGACC |
Binding Sites: | 4cn3_G 4cn3_H |
Publications: | Osz J, McEwen A.G, Poussin-Courmontagne P, Moutier E, Birck C, Davidson I, Moras D, Rochel N. Structural basis of natural promoter recognition by the retinoid X nuclear receptor. Scientific reports 5:8216 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.