Transcription Factor

						

			
Accessions: 2gli_A (3D-footprint 20231221)

			
Names: FIVE-FINGER GLI, GLI1_HUMAN, Glioma-associated oncogene, Oncogene GLI, Zinc finger protein GLI1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P08151
Length: 155
Pfam Domains:      9-27 C2H2-type zinc finger
    35-62 Zinc finger, C2H2 type
    55-80 Zinc-finger double domain
    68-92 C2H2-type zinc finger
    68-92 Zinc finger, C2H2 type
   84-111 Zinc-finger double domain
   98-123 Zinc finger, C2H2 type
   99-123 C2H2-type zinc finger
  117-141 Zinc-finger double domain
  129-154 C2H2-type zinc finger
  129-154 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMR   60
  61 RHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQN  120
 121 RTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG
Interface Residues: 14, 15, 17, 18, 21, 45, 47, 50, 51, 52, 53, 54, 56, 57, 59, 60, 63, 80, 81, 82, 83, 84, 85, 86, 87, 110, 111, 112, 113, 114, 115, 116, 117, 118, 121, 142, 143, 144, 145, 146, 147, 148, 149
3D-footprint Homologues: 5v3j_F, 6wmi_A, 7w1m_H, 2i13_A, 1ubd_C, 5yel_A, 6blw_A, 6jnm_A, 3uk3_C, 8cuc_F, 1tf3_A, 7y3l_A, 2gli_A, 1tf6_A, 5ei9_F, 6ml4_A, 6e94_A, 7ysf_A, 6a57_A, 5k5i_A, 2jpa_A, 5kkq_D, 8ssq_A, 8ssu_A, 7eyi_G, 8h9h_G, 1g2f_F, 7n5w_A, 6u9q_A, 4x9j_A, 1llm_D, 7txc_E, 5kl3_A, 5yj3_D, 1mey_C, 5und_A, 1f2i_J, 2kmk_A, 2lt7_A, 7y3m_I, 2wbs_A, 2drp_D, 4m9v_C
Binding Motifs: 2gli_A CGnnTTGGTTGGTC
Binding Sites: 2gli_C
2gli_D
			
Publications: Pavletich N.P, Pabo C.O. Crystal structure of a five-finger GLI-DNA complex: new perspectives on zinc fingers. Science (New York, N.Y.) 261:1701-7 (1993). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.