Transcription Factor

						

			
Accessions: 2d45_B (3D-footprint 20231221)

			
Names: MECI_STAAN, Methicillin resistance regulatory protein mecI
Organisms: Staphylococcus aureus, strain N315
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P68261
Length: 119
Pfam Domains:      6-62 MarR family
    6-119 Penicillinase repressor
Sequence: 
(in bold interface residues)		   1 NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKK   60
  61 DNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN
Interface Residues: 25, 41, 42, 44, 45, 46, 48, 49, 53, 65, 67
3D-footprint Homologues: 2p7c_B, 1xsd_A, 1sax_A
Binding Motifs: 2d45_AB TanTACATATGTA
2d45_B TAnTACA
Binding Sites: 2d45_E / 2d45_F
			
Publications: Safo M.K, Ko T.P, Musayev F.N, Zhao Q, Wang A.H, Archer G.L. Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec. Acta crystallographica. Section F, Structural biology and crystallization communications 62:320-4 (2006). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.