Transcription Factor
Accessions: | 2d45_B (3D-footprint 20241219) |
Names: | MECI_STAAN, Methicillin resistance regulatory protein mecI |
Organisms: | Staphylococcus aureus, strain N315 |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P68261 |
Length: | 119 |
Pfam Domains: | 6-62 MarR family 6-119 Penicillinase repressor |
Sequence: (in bold interface residues) | 1 NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKK 60 61 DNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILN |
Interface Residues: | 41, 42, 44, 45, 46, 49 |
3D-footprint Homologues: | 1sax_A, 1xsd_A |
Binding Motifs: | 2d45_AB TanTACATATGTA 2d45_B TAnTACA |
Binding Sites: | 2d45_E / 2d45_F |
Publications: | Safo M.K, Ko T.P, Musayev F.N, Zhao Q, Wang A.H, Archer G.L. Structure of the MecI repressor from Staphylococcus aureus in complex with the cognate DNA operator of mec. Acta crystallographica. Section F, Structural biology and crystallization communications 62:320-4 (2006). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.