Transcription Factor
Accessions: | pho (FlyZincFinger 1.0 ) |
Names: | CG17743 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 118 |
Pfam Domains: | 3-26 C2H2-type zinc finger 19-41 Zinc-finger double domain 31-53 C2H2-type zinc finger 31-53 Zinc finger, C2H2 type 46-71 Zinc-finger double domain 59-83 C2H2-type zinc finger 59-83 Zinc finger, C2H2 type 75-101 Zinc-finger double domain 89-113 Zinc finger, C2H2 type 89-113 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ 60 61 CTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKR |
Interface Residues: | 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 67, 71, 72, 73, 74, 75, 77, 78, 99, 101, 102, 103, 104, 105, 106, 107, 108, 112 |
3D-footprint Homologues: | 7w1m_H, 5ei9_F, 6ml4_A, 8ssq_A, 5yel_A, 8ssu_A, 5kkq_D, 8gn3_A, 4m9v_C, 7ysf_A, 2jpa_A, 1ubd_C, 7n5w_A, 6jnm_A, 1tf3_A, 8cuc_F, 7y3l_A, 4x9j_A, 5kl3_A, 7txc_E, 2kmk_A, 2drp_D, 6blw_A, 5k5i_A, 2gli_A, 1tf6_A, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 4gnx_Z, 3uk3_C, 5yj3_D, 1g2f_F, 1llm_D, 5v3j_F, 6u9q_A, 1f2i_J, 2wbs_A, 7y3m_I |
Binding Motifs: | pho_FlyReg_FBgn0002521 rscgTtATGGCttm pho_SANGER_10_FBgn0002521 mAaaATGGCGGc pho_SOLEXA_5_FBgn0002521 ammAwaATGGCGgmy |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.