Transcription Factor

Accessions: pho (FlyZincFinger 1.0 )
Names: CG17743
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 118
Pfam Domains: 3-26 C2H2-type zinc finger
19-41 Zinc-finger double domain
31-53 C2H2-type zinc finger
31-53 Zinc finger, C2H2 type
46-71 Zinc-finger double domain
59-83 C2H2-type zinc finger
59-83 Zinc finger, C2H2 type
75-101 Zinc-finger double domain
89-113 C2H2-type zinc finger
89-113 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 KIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ 60
61 CTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKR
Interface Residues: 14, 15, 17, 18, 20, 21, 22, 23, 24, 41, 42, 43, 44, 45, 47, 48, 71, 72, 73, 74, 75, 78, 101, 102, 103, 104, 105, 108, 112
3D-footprint Homologues: 7w1m_H, 8ssq_A, 8ssu_A, 8gn3_A, 7ysf_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 2kmk_A, 2drp_D, 2gli_A, 1tf6_A, 7txc_E, 8h9h_G, 6e94_A, 2lt7_A, 6u9q_A, 5v3j_F, 7y3m_I
Binding Motifs: pho_FlyReg_FBgn0002521 rscgTtATGGCttm
pho_SANGER_10_FBgn0002521 mAaaATGGCGGc
pho_SOLEXA_5_FBgn0002521 ammAwaATGGCGgmy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.