Transcription Factor

Accessions: ZNF669 (humanC2H2ZF-ChIP Feb2015), Q96BR6 (JASPAR 2024)
Names: ENSG00000188295, Q96BR6, ZNF669, ZN669_HUMAN
Organisms: Homo sapiens
Libraries: humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2
1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC
Length: 464
Pfam Domains: 90-130 KRAB box
190-211 C2H2-type zinc finger
190-204 C2H2-type zinc finger
190-211 Zinc finger, C2H2 type
204-233 Zinc-finger double domain
222-244 C2H2-type zinc finger
237-260 Zinc-finger double domain
250-262 C2H2-type zinc finger
250-272 Zinc finger, C2H2 type
250-272 C2H2-type zinc finger
266-288 Zinc-finger double domain
277-287 C2H2-type zinc finger
296-315 Zinc-finger double domain
305-316 C2H2-type zinc finger
306-328 Zinc finger, C2H2 type
306-328 C2H2-type zinc finger
321-345 Zinc-finger double domain
333-352 C2H2-type zinc finger
334-352 C2H2-type zinc finger
348-373 Zinc-finger double domain
361-384 C2H2-type zinc finger
362-384 Zinc finger, C2H2 type
362-384 C2H2-type zinc finger
380-401 Zinc-finger double domain
389-405 C2H2-type zinc finger
390-412 Zinc finger, C2H2 type
390-412 C2H2-type zinc finger
408-428 Zinc-finger double domain
417-440 C2H2-type zinc finger
418-440 C2H2-type zinc finger
418-440 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCSGPGRAGRAAE 60
61 PLHPVCTCGRHFRRPEPCREPLASPIQDSVAFEDVAVNFTQEEWALLDSSQKNLYREVMQ 120
121 ETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE 180
181 NISTGLKPCECSICGKVFVRHSLLNRHILAHSGYKPYGEKQYKCEQCGKFFVSVPGVRRH 240
241 MIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTH 300
301 TGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFSCSTSLRYHGSIHTGER 360
361 PYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHLHERIHTGEKPYEC 420
421 KKCGKAYTRSSHLTRHERSHDIEAGCSDSAYNPSTLGGQGVWIA
Interface Residues: 200, 202, 203, 206, 214, 232, 233, 235, 236, 239, 242, 260, 261, 262, 263, 264, 266, 267, 289, 290, 291, 292, 295, 299, 316, 317, 318, 319, 320, 322, 323, 344, 345, 346, 347, 348, 350, 351, 353, 354, 355, 357, 362, 372, 373, 374, 375, 376, 378, 379, 380, 385, 399, 400, 401, 402, 403, 404, 405, 407, 408, 411, 428, 429, 430, 431, 432, 435, 438
3D-footprint Homologues: 7w1m_H, 8ssq_A, 8ssu_A, 8cuc_F, 7n5w_A, 6jnm_A, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 2gli_A, 1tf6_A, 5ei9_F, 6e94_A, 5yel_A, 7y3l_A, 3uk3_C, 5kkq_D, 5k5i_A, 6ml4_A, 1g2f_F, 2jpa_A, 2kmk_A, 1tf3_A, 6blw_A, 6u9q_A, 4x9j_A, 5kl3_A, 7txc_E, 2drp_D, 4m9v_C, 5k5l_F, 1f2i_J, 2wbs_A, 8gn3_A, 1llm_D, 5yj3_D
Binding Motifs: ZNF669_ChIP GTCATCr
MA1985.1 gGGgyGAyGACCrcT
Publications: Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.