Transcription Factor
| Accessions: | ZNF669 (humanC2H2ZF-ChIP Feb2015), Q96BR6 (JASPAR 2024) |
| Names: | ENSG00000188295, Q96BR6, ZNF669, ZN669_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | humanC2H2ZF-ChIP Feb2015 1, JASPAR 2024 2 1 Najafabadi HS, Mnaimneh S, Schmitges FW, Garton M, Lam KN, Yang A, Albu M, Weirauch MT, Radovani E, Kim PM, Greenblatt J, Frey BJ, Hughes TR. C2H2 zinc finger proteins greatly expand the human regulatory lexicon. Nat Biotechnol 33:555-62 (2015). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: C2H2;KRAB experiment: ChIP-seq/MEME/B1H-RC |
| Length: | 464 |
| Pfam Domains: | 90-130 KRAB box 190-211 Zinc finger, C2H2 type 190-211 C2H2-type zinc finger 190-204 C2H2-type zinc finger 204-233 Zinc-finger double domain 222-244 C2H2-type zinc finger 237-260 Zinc-finger double domain 250-262 C2H2-type zinc finger 250-272 Zinc finger, C2H2 type 250-272 C2H2-type zinc finger 266-288 Zinc-finger double domain 277-287 C2H2-type zinc finger 296-315 Zinc-finger double domain 305-316 C2H2-type zinc finger 306-328 Zinc finger, C2H2 type 306-328 C2H2-type zinc finger 321-345 Zinc-finger double domain 333-352 C2H2-type zinc finger 334-352 C2H2-type zinc finger 348-373 Zinc-finger double domain 361-384 C2H2-type zinc finger 362-384 Zinc finger, C2H2 type 362-384 C2H2-type zinc finger 380-401 Zinc-finger double domain 389-405 C2H2-type zinc finger 390-412 Zinc finger, C2H2 type 390-412 C2H2-type zinc finger 408-428 Zinc-finger double domain 417-440 C2H2-type zinc finger 418-440 Zinc finger, C2H2 type 418-440 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCSGPGRAGRAAE 60 61 PLHPVCTCGRHFRRPEPCREPLASPIQDSVAFEDVAVNFTQEEWALLDSSQKNLYREVMQ 120 121 ETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE 180 181 NISTGLKPCECSICGKVFVRHSLLNRHILAHSGYKPYGEKQYKCEQCGKFFVSVPGVRRH 240 241 MIMHSGNPAYKCTICGKAFYFLNSVERHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTH 300 301 TGEKPYECKECGKTFRFSCSFKTHERTHTGERPYKCTKCDKAFSCSTSLRYHGSIHTGER 360 361 PYECKQCGKAFSRLSSLCNHRSTHTGEKPYECKQCDQAFSRLSSLHLHERIHTGEKPYEC 420 421 KKCGKAYTRSSHLTRHERSHDIEAGCSDSAYNPSTLGGQGVWIA |
| Interface Residues: | 200, 202, 203, 206, 214, 232, 233, 235, 236, 239, 242, 260, 261, 262, 263, 264, 266, 267, 289, 290, 291, 292, 295, 299, 316, 317, 318, 319, 320, 322, 323, 344, 345, 346, 347, 348, 350, 351, 353, 354, 355, 357, 362, 372, 373, 374, 375, 376, 378, 379, 380, 385, 399, 400, 401, 402, 403, 404, 405, 407, 408, 411, 428, 429, 430, 431, 432, 435, 438 |
| 3D-footprint Homologues: | 8ssq_A, 7w1m_H, 8ssu_A, 7n5w_A, 6jnm_A, 8cuc_F, 5v3j_F, 8h9h_G, 7y3m_I, 7ysf_A, 2lt7_A, 6a57_A, 1ubd_C, 2gli_A, 1tf6_A, 5ei9_F, 6e94_A, 5yel_A, 7y3l_A, 3uk3_C, 5kkq_D, 5k5i_A, 6ml4_A, 1g2f_F, 2jpa_A, 2kmk_A, 1tf3_A, 4x9j_A, 5kl3_A, 7txc_E, 2drp_D, 6blw_A, 6u9q_A, 4m9v_C, 1f2i_J, 2wbs_A, 8gn3_A, 1llm_D, 5k5l_F, 5yj3_D |
| Binding Motifs: | ZNF669_ChIP GTCATCr MA1985.1 gGGgyGAyGACCrcT |
| Publications: | Schmitges FW, Radovani E, Najafabadi HS, Barazandeh M, Campitelli LF, Yin Y, Jolma A, Zhong G, Guo H, Kanagalingam T, Dai WF, Taipale J, Emili A, Greenblatt JF, Hughes TR. Multiparameter functional diversity of human C2H2 zinc finger proteins. Genome Res 26:1742-1752 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.