Transcription Factor
| Accessions: | T09309 (AthalianaCistrome v4_May2016), Q9AT61 (JASPAR 2024) |
| Names: | AT2G30340, LBD13, T09309;, AS2-like protein 10, ASYMMETRIC LEAVES 2-like protein 10, LBD13_ARATH, LOB domain-containing protein 13 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:LOB-AS2 |
| Length: | 268 |
| Pfam Domains: | 52-151 Protein of unknown function DUF260 |
| Sequence: | MSREREGFGEYYETVKKIKKDPAFETTTDHAVMGIRRHVAVPPGTTLNTVTPCAACKLLR RRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRL RDPIYGCMGAISALQHHIQSLQSELTTVRTEILRHKYQEATTITSLQNNFNSTTTTSSVS CDQHALASAILLPPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSPSMVVSSSSSSNSSAT NSMYNPPPSSTAGYSNSLSSDNNVHYFD |
| Binding Motifs: | M0471 CGsCGgadwwtrCGG M0475 cGsCGgarwwkrCGGcG MA2021.1 yctCCACCGtmdh MA2021.2 tCCACCGt |
| Binding Sites: | MA2021.1.1 MA2021.1.10 MA2021.1.11 MA2021.1.12 MA2021.1.13 MA2021.1.14 MA2021.1.15 MA2021.1.16 MA2021.1.17 MA2021.1.18 MA2021.1.19 MA2021.1.2 MA2021.1.20 MA2021.1.3 MA2021.1.4 MA2021.1.5 MA2021.1.6 MA2021.1.7 MA2021.1.8 MA2021.1.9 MA2021.2.1 / MA2021.2.15 MA2021.2.10 MA2021.2.11 / MA2021.2.4 MA2021.2.12 / MA2021.2.19 MA2021.2.13 MA2021.2.14 / MA2021.2.5 MA2021.2.16 / MA2021.2.7 MA2021.2.17 MA2021.2.18 / MA2021.2.9 MA2021.2.2 / MA2021.2.20 MA2021.2.3 MA2021.2.6 MA2021.2.8 |
| Publications: | Husbands A, Bell EM, Shuai B, Smith HM, Springer PS. LATERAL ORGAN BOUNDARIES defines a new family of DNA-binding transcription factors and can interact with specific bHLH proteins. Nucleic Acids Res : (2007;35(19):6663-71.). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.