Transcription Factor
Accessions: | AtbZIP1 (EEADannot 2025-01-07) |
Names: | Q9FGX2;BZIP1_ARATH;AT5G49450.1 |
Organisms: | Arabidopsis thaliana |
Libraries: | EEADannot 2025-01-07 1 1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
Notes: | family:bZIP |
Length: | 145 |
Pfam Domains: | 14-55 Basic region leucine zipper 15-81 bZIP transcription factor |
Sequence: | MANAEKTSSGSDIDEKKRKRKLSNRESARRSRLKKQKLMEDTIHEISSLERRIKENSERC RAVKQRLDSVETENAGLRSEKIWLSSYVSDLENMIATTSLTLTQSGGGDCVDDQNANAGI AVGDCRRTPWKLSCGSLQPMASFKT |
Binding Motifs: | EEAD0092 mTGACGTGGCa EEAD0093 TGmCACGTGkm EEAD0102 tGmCACGTsd EEAD0103 ccACGTCAkCa EEAD0104 vwsACGTGKCa EEAD0105 ysACGTCAkCa EEAD0106 kCCACGTCAkc EEAD0107 tGmCACGTGkm |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.