Transcription Factor

Accessions: 3a01_B (3D-footprint 20231221)
Names: AL_DROME, Homeobox protein aristaless
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q06453
Length: 57
Pfam Domains: 1-57 Homeobox domain
Sequence:
(in bold interface residues)
1 RRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK
Interface Residues: 1, 2, 3, 4, 42, 43, 45, 46, 49, 50, 53, 54, 57
3D-footprint Homologues: 1puf_A, 3cmy_A, 1fjl_B, 6a8r_A, 3d1n_M, 1ig7_A, 5zfz_A, 2h1k_B, 3lnq_A, 2lkx_A, 1nk2_P, 1zq3_P, 1jgg_B, 6m3d_C, 7q3o_C, 6es3_K, 2ld5_A, 5flv_I, 5zjt_E, 2hdd_A, 7psx_B, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 2hos_A, 1b72_A, 5jlw_D, 4cyc_A, 4xrs_G, 3a01_E, 1e3o_C, 1le8_A, 2xsd_C, 7xrc_C, 4j19_B, 8g87_X, 4qtr_D, 4xrm_B, 3l1p_A, 1o4x_A, 1du0_A
Binding Motifs: 3a01_AB TTAATTAATTG
Binding Sites: 3a01_C
3a01_D
Publications: Miyazono K, Zhi Y, Takamura Y, Nagata K, Saigo K, Kojima T, Tanokura M. Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless. The EMBO journal 29:1613-23 (2010). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.