Transcription Factor

Accessions: 6y37_A (3D-footprint 20241219)
Names: G5EAZ0_EMENI, HapB
Organisms: Emericella nidulans, Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: G5EAZ0
Length: 60
Pfam Domains: 1-58 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B
Sequence:
(in bold interface residues)
1 ESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLT 60
Interface Residues: 43, 46, 50, 52, 57, 58
3D-footprint Homologues: 6r2v_A
Binding Motifs: 6y37_A CCAATCAnnnCG
Binding Sites: 6y37_D
6y37_E
Publications: Hortschansky P, Misslinger M, Mörl J, Gsaller F, Bromley MJ, Brakhage AA, Groll M, Haas H, Huber EM. Structural basis of HapE(P88L)-linked antifungal triazole resistance in Aspergillus fumigatus. Life Sci Alliance : (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.