Transcription Factor
Accessions: | 6y37_A (3D-footprint 20241219) |
Names: | G5EAZ0_EMENI, HapB |
Organisms: | Emericella nidulans, Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | G5EAZ0 |
Length: | 60 |
Pfam Domains: | 1-58 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B |
Sequence: (in bold interface residues) | 1 ESPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLT 60 |
Interface Residues: | 43, 46, 50, 52, 57, 58 |
3D-footprint Homologues: | 6r2v_A |
Binding Motifs: | 6y37_A CCAATCAnnnCG |
Binding Sites: | 6y37_D 6y37_E |
Publications: | Hortschansky P, Misslinger M, Mörl J, Gsaller F, Bromley MJ, Brakhage AA, Groll M, Haas H, Huber EM. Structural basis of HapE(P88L)-linked antifungal triazole resistance in Aspergillus fumigatus. Life Sci Alliance : (2020). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.