Transcription Factor
| Accessions: | 5i50_B (3D-footprint 20231221) |
| Names: | bHLHe39, Class E basic helix-loop-helix protein 39, Myc proto-oncogene protein, MYC_HUMAN, Proto-oncogene c-Myc, Transcription factor p64 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P01106 |
| Length: | 96 |
| Pfam Domains: | 12-64 Helix-loop-helix DNA-binding domain 65-96 Myc leucine zipper domain |
| Sequence: (in bold interface residues) | 1 FQGAMATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYI 60 61 LSVQAETQKLISEIDLLRKQNEQLKHKLEQLRNSCA |
| Interface Residues: | 13, 15, 16, 17, 19, 20, 21, 23, 24, 25, 29, 49, 89, 90, 91, 92, 93 |
| 3D-footprint Homologues: | 1a0a_B, 7z5k_B, 1an4_A, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 7f2f_B, 5eyo_A, 5v0l_A, 1am9_A, 7rcu_E, 5gnj_I, 6g1l_A, 7ssa_L, 5i50_B, 7xq5_A, 8eb5_A, 8edg_C |
| Binding Motifs: | 5i50_AB CCACGTGAA 5i50_B CgTGG |
| Binding Sites: | 5i50_C 5i50_D |
| Publications: | Jung LA, Gebhardt A, Koelmel W, Ade CP, Walz S, Kuper J, von Eyss B, Letschert S, Redel C, d'Artista L, Biankin A, Zender L, Sauer M, Wolf E, Evan G, Kisker C, Eilers M. OmoMYC blunts promoter invasion by oncogenic MYC to inhibit gene expression characteristic of MYC-dependent tumors. Oncogene : (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.