Transcription Factor
Accessions: | ECK120004911 (RegulonDB 7.5) |
Names: | HipB |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | sequence-specific DNA binding; cytoplasm; Transcription related; repressor; transcription, DNA-dependent; transcription repressor activity |
Length: | 89 |
Pfam Domains: | 12-65 Helix-turn-helix domain 13-67 Helix-turn-helix domain 16-67 Helix-turn-helix domain 18-69 Helix-turn-helix 22-67 Cro/C1-type HTH DNA-binding domain |
Sequence: (in bold interface residues) | 1 MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKI 60 61 LQSLELSMTLCDAKNASPESTEQQNLEW* |
Interface Residues: | 28, 38, 39, 40, 41, 43, 44, 54, 55, 56, 58, 59 |
3D-footprint Homologues: | 8bx1_A, 7u0g_M, 1zvv_A, 8g87_X, 6y93_B, 7ol9_B, 7vo0_N, 7vpz_N, 7x74_H |
Binding Motifs: | HipB TATCCbbKWdhGMGGATAA |
Binding Sites: | ECK125135151 ECK125135153 ECK125135155 ECK125135157 |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.