Transcription Factor

Accessions: ECK120004911 (RegulonDB 7.5)
Names: HipB
Organisms: ECK12
Libraries: RegulonDB 7.5 1
1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed]
Notes: sequence-specific DNA binding; cytoplasm; Transcription related; repressor; transcription, DNA-dependent; transcription repressor activity
Length: 89
Pfam Domains: 12-65 Helix-turn-helix domain
13-67 Helix-turn-helix domain
16-67 Helix-turn-helix domain
18-69 Helix-turn-helix
22-67 Cro/C1-type HTH DNA-binding domain
Sequence:
(in bold interface residues)
1 MMSFQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKI 60
61 LQSLELSMTLCDAKNASPESTEQQNLEW*
Interface Residues: 28, 29, 38, 39, 40, 41, 43, 44, 47, 50, 51
3D-footprint Homologues: 3cro_R, 3oqm_C, 1per_L, 3zkc_A, 5k98_B, 3dnv_B, 4z5h_A, 4lln_I, 5gpc_B
Binding Motifs: HipB TATCCbbKWdhGMGGATAA
Binding Sites: ECK125135151
ECK125135153
ECK125135155
ECK125135157
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.