Transcription Factor
| Accessions: | 2ff0_A (3D-footprint 20250804) |
| Names: | Adrenal 4-binding protein, ELP, Embryonal long terminal repeat-binding protein, Embryonal LTR-binding protein, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, SF-1, Steroid hormone receptor Ad4BP, Steroid hydroxylase positive regulator, Steroidogenic factor 1, STF-1, STF1_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P33242 |
| Length: | 102 |
| Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCR 60 61 FQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKA |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54, 76, 78, 80, 83, 85 |
| 3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A |
| Binding Motifs: | 2ff0_A TGgCCCtGA |
| Binding Sites: | 2ff0_B 2ff0_C |
| Publications: | Little T.H, Zhang Y, Matulis C.K, Weck J, Zhang Z, Ramachandran A, Mayo K.E, Radhakrishnan I. Sequence-specific deoxyribonucleic acid (DNA) recognition by steroidogenic factor 1: a helix at the carboxy terminus of the DNA binding domain is necessary for complex stability. Molecular endocrinology (Baltimore, Md.) 20:831-43 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.