Transcription Factor

Accessions: 2ff0_A (3D-footprint 20231221)
Names: Adrenal 4-binding protein, ELP, Embryonal long terminal repeat-binding protein, Embryonal LTR-binding protein, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, SF-1, Steroid hormone receptor Ad4BP, Steroid hydroxylase positive regulator, Steroidogenic factor 1, STF-1, STF1_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P33242
Length: 102
Pfam Domains: 3-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 DELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKTQRKRCPFCR 60
61 FQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKA
Interface Residues: 10, 12, 13, 14, 15, 16, 22, 23, 25, 26, 29, 30, 54, 76, 78, 80, 83, 85
3D-footprint Homologues: 8dwj_A, 6fbq_A, 7wnh_D, 6l6q_B, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B
Binding Motifs: 2ff0_A TGgCCCtGA
Binding Sites: 2ff0_B
2ff0_C
Publications: Little T.H, Zhang Y, Matulis C.K, Weck J, Zhang Z, Ramachandran A, Mayo K.E, Radhakrishnan I. Sequence-specific deoxyribonucleic acid (DNA) recognition by steroidogenic factor 1: a helix at the carboxy terminus of the DNA binding domain is necessary for complex stability. Molecular endocrinology (Baltimore, Md.) 20:831-43 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.