Transcription Factor
| Accessions: | 1rio_H (3D-footprint 20250804) |
| Names: | SIGA_THEAQ, sigma factor SigA |
| Organisms: | Thermus aquaticus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9EZJ8 |
| Length: | 61 |
| Pfam Domains: | 7-59 Sigma-70, region 4 |
| Sequence: (in bold interface residues) | 1 SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY 60 61 H |
| Interface Residues: | 33, 34, 43, 44, 45, 46, 48, 49 |
| 3D-footprint Homologues: | 6ido_B, 3n97_A, 8cyf_B |
| Binding Motifs: | 1rio_ABH TAnCACCGCnAGTACTTGAC 1rio_H cTTGACa |
| Binding Sites: | 1rio_T 1rio_U |
| Publications: | Jain D, Nickels B.E, Sun L, Hochschild A, Darst S.A. Structure of a ternary transcription activation complex. Molecular cell 13:45-53 (2004). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.