Transcription Factor

Accessions: 1rio_H (3D-footprint 20260701)
Names: SIGA_THEAQ, sigma factor SigA
Organisms: Thermus aquaticus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9EZJ8
Length: 61
Pfam Domains: 7-59 Sigma-70, region 4
Sequence:
(in bold interface residues)
1 SEELEKALSKLSEREAMVLKLRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLKY 60
61 H
Interface Residues: 33, 34, 43, 44, 45, 46, 48, 49
3D-footprint Homologues: 6ido_B, 3n97_A, 8cyf_B
Binding Motifs: 1rio_ABH TAnCACCGCnAGTACTTGAC
1rio_H cTTGACa
Binding Sites: 1rio_T
1rio_U
Publications: Jain D, Nickels B.E, Sun L, Hochschild A, Darst S.A. Structure of a ternary transcription activation complex. Molecular cell 13:45-53 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.