Transcription Factor
| Accessions: | 1k6o_C (3D-footprint 20250804) |
| Names: | Serum response factor, SRF_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P11831 |
| Length: | 84 |
| Pfam Domains: | 12-62 SRF-type transcription factor (DNA-binding and dimerisation domain) |
| Sequence: (in bold interface residues) | 1 KKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTF 60 61 ATRKLQPMITSETGKALIQTCLNS |
| Interface Residues: | 3, 6, 7, 18, 21, 22, 26 |
| 3D-footprint Homologues: | 1hbx_A, 8q9p_B, 1c7u_A, 1n6j_A, 8q9q_A, 1egw_B, 7xuz_H, 8q9r_F, 8q9n_B, 1mnm_A |
| Binding Motifs: | 1k6o_ABC AGGATnTCCATATTAGGA |
| Binding Sites: | 1k6o_D 1k6o_E |
| Publications: | Mo Y, Ho W, Johnston K, Marmorstein R. Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex. Journal of molecular biology 314:495-506 (2001). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.