Transcription Factor
| Accessions: | Q6QHK4 (JASPAR 2024) |
| Names: | bHLHc8, Class C basic helix-loop-helix protein 8, Factor in the germline alpha, FIGalpha, FIGLA_HUMAN, Folliculogenesis-specific basic helix-loop-helix protein, Transcription factor FIGa |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q6QHK4 |
| Length: | 219 |
| Pfam Domains: | 66-117 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL 60 61 QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL 120 121 LEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSG 180 181 EPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV |
| Interface Residues: | 67, 69, 70, 71, 73, 74, 75, 76, 77, 78, 81, 82, 84, 101, 214 |
| 3D-footprint Homologues: | 7z5k_B, 8osb_B, 2ypa_A, 1an4_A, 5eyo_A, 6od3_F, 5i50_B, 2ypa_B, 2ql2_D, 5gnj_I, 7f2f_B, 6g1l_A, 8u0j_A |
| Binding Motifs: | MA0820.1 wmCACCTGkw MA1934.1 rcCGGAwrCAssTGky MA1941.1 rsCGGAArCAGsTGgd MA1945.1 rgmGGAArCAGGTGg UN0529.1 rsmGGAwrCAssTGb MA0820.2 CACCTG MA1934.2 cCGGAwrCAssTG MA1941.2 sCGGAArCAGsTG MA1945.2 rgmGGAArCAGGTG UN0529.2 smGGAwrCAssTG |
| Publications: | Zhao H, Chen ZJ, Qin Y, Shi Y, Wang S, Choi Y, Simpson JL, Rajkovic A. Transcription factor FIGLA is mutated in patients with premature ovarian failure. Am J Hum Genet 82:1342-8 (2008). [Pubmed] Guturu H, Doxey AC, Wenger AM, Bejerano G. Structure-aided prediction of mammalian transcription factor complexes in conserved non-coding elements. Philos Trans R Soc Lond B Biol Sci 368:20130029 (2013). [Pubmed] Ibarra IL, Hollmann NM, Klaus B, Augsten S, Velten B, Hennig J, Zaugg JB. Mechanistic insights into transcription factor cooperativity and its impact on protein-phenotype interactions. Nat Commun 11:124 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.