Transcription Factor

						

			
Accessions: 6ml3_A (3D-footprint 20231221)

			
Names: Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q80X44
Length: 112
Pfam Domains:      4-25 Zinc finger, C2H2 type
     4-25 C2H2-type zinc finger
     4-24 Zinc-finger of C2H2 type
     4-25 C2H2-type zinc finger
    18-41 Zinc-finger double domain
    30-54 C2H2-type zinc finger
    31-53 Zinc finger, C2H2 type
    31-53 C2H2-type zinc finger
    31-53 Zinc-finger of C2H2 type
    45-69 Zinc-finger double domain
    59-70 C2H2-type zinc finger
    59-81 Zinc finger, C2H2 type
    59-81 C2H2-type zinc finger
    75-97 Zinc-finger double domain
   87-107 C2H2-type zinc finger
   87-109 Zinc finger, C2H2 type
   87-109 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 SLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYS   60
  61 CSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKE
Interface Residues: 13, 14, 15, 16, 17, 19, 20, 22, 23, 26, 31, 41, 42, 43, 44, 45, 47, 48, 49, 52, 69, 70, 71, 72, 73, 74, 75, 76, 77, 97, 98, 99, 100, 101, 103, 104, 107
3D-footprint Homologues: 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 5kl3_A, 1f2i_J, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 3w6v_A, 2gli_A, 8ssu_A, 6ml4_A, 5v3j_F, 8gn3_A, 5kkq_D, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 1tf6_A, 2i13_A, 7y3m_I, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 6jnm_A, 1mey_C, 1g2f_F, 5k5i_A, 1llm_D, 6blw_A, 6u9q_A, 5yel_A, 4m9v_C, 2lt7_A, 6a57_A, 7txc_E, 2drp_D, 2wbs_A, 5yj3_D
Binding Motifs: 6ml3_A CTTCCAGGACCTg
Binding Sites: 6ml3_E
6ml3_F
			
Publications: Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.