Transcription Factor
Accessions: | ECK120004771 (RegulonDB 7.5) |
Names: | FhlA, FhlA transcriptional activator |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | transcription factor binding; regulation of transcription, DNA-dependent; intracellular; ATP binding; sequence-specific DNA binding transcription factor activity; DNA binding; nucleotide binding; two-component signal transduction system (phosphorelay); transcription, DNA-dependent; fermentation; operon; activator; Transcription related; cytoplasm; nucleoside-triphosphatase activity |
Length: | 693 |
Pfam Domains: | 202-345 GAF domain 202-346 GAF domain 202-344 GAF domain 381-548 Sigma-54 interaction domain 405-529 AAA domain (dynein-related subfamily) 405-525 ATPase family associated with various cellular activities (AAA) 645-684 Bacterial regulatory protein, Fis family |
Sequence: (in bold interface residues) | 1 MSYTPMSDLGQQGLFDITRTLLQQPDLASLCEALSQLVKRSALADNAAIVLWQAQTQRAS 60 61 YYASREKDTPIKYEDETVLAHGPVRSILSRPDTLHCSYEEFCETWPQLDAGGLYPKFGHY 120 121 CLMPLAAEGHIFGGCEFIRYDDRPWSEKEFNRLQTFTQIVSVVTEQIQSRVVNNVDYELL 180 181 CRERDNFRILVAITNAVLSRLDMDELVSEVAKEIHYYFDIDDISIVLRSHRKNKLNIYST 240 241 HYLDKQHPAHEQSEVDEAGTLTERVFKSKEMLLINLHERDDLAPYERMLFDTWGNQIQTL 300 301 CLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLLRQIAERVAIAVDNALAYQEIHRLKERL 360 361 VDENLALTEQLNNVDSEFGEIIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKELIAR 420 421 AIHNLSGRNNRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLD 480 481 EVGDMPLELQPKLLRVLQEQEFERLGSNKIIQTDVRLIAATNRDLKKMVADREFRSDLYY 540 541 RLNVFPIHLPPLRERPEDIPLLAKAFTFKIARRLGRNIDSIPAETLRTLSNMEWPGNVRE 600 601 LENVIERAVLLTRGNVLQLSLPDIVLPEPETPPAATVVALEGEDEYQLIVRVLKETNGVV 660 661 AGPKGAAQRLGLKRTTLLSRMKRLGIDKSALI* |
Interface Residues: | 448, 453, 454, 455 |
3D-footprint Homologues: | 5fhd_A, 8eaf_A |
Binding Motifs: | FhlA YGKCRAmAmkGmcr |
Binding Sites: | ECK120011396 ECK120013095 ECK120013097 ECK120013099 ECK125109813 ECK125109814 ECK125109815 |
Publications: | Iuchi S., Lin EC. Adaptation of Escherichia coli to redox environments by gene expression. Mol Microbiol. 9(1):9-15 (1993). [Pubmed] Andrews SC., Berks BC., McClay J., Ambler A., Quail MA., Golby P., Guest JR. A 12-cistron Escherichia coli operon (hyf) encoding a putative proton-translocating formate hydrogenlyase system. Microbiology. 143 ( Pt 11):3633-47 (1997). [Pubmed] Self WT., Hasona A., Shanmugam KT. Expression and regulation of a silent operon, hyf, coding for hydrogenase 4 isoenzyme in Escherichia coli. J Bacteriol. 186(2):580-7 (2004). [Pubmed] Maupin JA., Shanmugam KT. Genetic regulation of formate hydrogenlyase of Escherichia coli: role of the fhlA gene product as a transcriptional activator for a new regulatory gene, fhlB. J Bacteriol. 172(9):4798-806 (1990). [Pubmed] Sankar P., Lee JH., Shanmugam KT. Gene-product relationships of fhlA and fdv genes of Escherichia coli. J Bacteriol. 170(12):5440-5 (1988). [Pubmed] Schlensog V., Bock A. Identification and sequence analysis of the gene encoding the transcriptional activator of the formate hydrogenlyase system of Escherichia coli. Mol Microbiol. 4(8):1319-27 (1990). [Pubmed] Rossmann R., Sawers G., Bock A. Mechanism of regulation of the formate-hydrogenlyase pathway by oxygen, nitrate, and pH: definition of the formate regulon. Mol Microbiol. 5(11):2807-14 (1991). [Pubmed] Hopper S., Babst M., Schlensog V., Fischer HM., Hennecke H., Bock A. Regulated expression in vitro of genes coding for formate hydrogenlyase components of Escherichia coli. J Biol Chem. 269(30):19597-604 (1994). [Pubmed] Maeda T., Sanchez-Torres V., Wood TK. Enhanced hydrogen production from glucose by metabolically engineered Escherichia coli. Appl Microbiol Biotechnol. 77(4):879-90 (2007). [Pubmed] Maeda T., Sanchez-Torres V., Wood TK. Escherichia coli hydrogenase 3 is a reversible enzyme possessing hydrogen uptake and synthesis activities. Appl Microbiol Biotechnol. 76(5):1035-42 (2007). [Pubmed] Schlensog V., Lutz S., Bock A. Purification and DNA-binding properties of FHLA, the transcriptional activator of the formate hydrogenlyase system from Escherichia coli. J Biol Chem. 269(30):19590-6 (1994). [Pubmed] Sauter M., Bohm R., Bock A. Mutational analysis of the operon (hyc) determining hydrogenase 3 formation in Escherichia coli. Mol Microbiol. 6(11):1523-32 (1992). [Pubmed] Repoila F., Majdalani N., Gottesman S. Small non-coding RNAs, co-ordinators of adaptation processes in Escherichia coli: the RpoS paradigm. Mol Microbiol. 48(4):855-61 (2003). [Pubmed] Argaman L., Altuvia S. fhlA repression by OxyS RNA: kissing complex formation at two sites results in a stable antisense-target RNA complex. J Mol Biol. 300(5):1101-12 (2000). [Pubmed] Altuvia S., Zhang A., Argaman L., Tiwari A., Storz G. The Escherichia coli OxyS regulatory RNA represses fhlA translation by blocking ribosome binding. EMBO J. 17(20):6069-75 (1998). [Pubmed] Altuvia S., Weinstein-Fischer D., Zhang A., Postow L., Storz G. A small, stable RNA induced by oxidative stress: role as a pleiotropic regulator and antimutator. Cell. 90(1):43-53 (1997). [Pubmed] Self WT., Hasona A., Shanmugam KT. N-terminal truncations in the FhlA protein result in formate- and MoeA-independent expression of the hyc (formate hydrogenlyase) operon of Escherichia coli. Microbiology. 147(Pt 11):3093-104 (2001). [Pubmed] Hopper S., Bock A. Effector-mediated stimulation of ATPase activity by the sigma 54-dependent transcriptional activator FHLA from Escherichia coli. J Bacteriol. 177(10):2798-803 (1995). [Pubmed] Leonhartsberger S., Ehrenreich A., Bock A. Analysis of the domain structure and the DNA binding site of the transcriptional activator FhlA. Eur J Biochem. 267(12):3672-84 (2000). [Pubmed] Weiss DS., Batut J., Klose KE., Keener J., Kustu S. The phosphorylated form of the enhancer-binding protein NTRC has an ATPase activity that is essential for activation of transcription. Cell. 67(1):155-67 (1991). [Pubmed] Korsa I., Bock A. Characterization of fhlA mutations resulting in ligand-independent transcriptional activation and ATP hydrolysis. J Bacteriol. 179(1):41-5 (1997). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.