Transcription Factor

Accessions: 6j4f_F (3D-footprint 20241219)
Names: Probable WRKY transcription factor 2, WRKY DNA-binding protein 2, WRKY2_ARATH
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9FG77
Length: 63
Pfam Domains: 4-60 WRKY DNA -binding domain
Sequence:
(in bold interface residues)
1 APAEDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSREGHITEIIYKGAHNHL 60
61 KPL
Interface Residues: 11, 12, 14, 15, 26
3D-footprint Homologues: 7z0u_A
Binding Motifs: 6j4f_F GGTnnAAG
Binding Sites: 6j4f_G
6j4f_H
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.