Transcription Factor

Accessions: Q3TDE8 (JASPAR 2024)
Names: ZN691_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 283
Pfam Domains: 82-103 C2H2-type zinc finger
83-105 C2H2-type zinc finger
83-105 Zinc finger, C2H2 type
97-122 Zinc-finger double domain
110-122 C2H2-type zinc finger
111-133 C2H2-type zinc finger
111-133 Zinc finger, C2H2 type
128-149 Zinc-finger double domain
139-161 C2H2-type zinc finger
139-161 C2H2-type zinc finger
139-161 Zinc finger, C2H2 type
153-178 Zinc-finger double domain
167-189 Zinc finger, C2H2 type
167-179 C2H2-type zinc finger
167-189 C2H2-type zinc finger
182-206 Zinc-finger double domain
195-217 Zinc finger, C2H2 type
195-217 C2H2-type zinc finger
195-217 C2H2-type zinc finger
213-233 Zinc-finger double domain
222-247 C2H2-type zinc finger
223-245 Zinc finger, C2H2 type
223-245 C2H2-type zinc finger
240-261 Zinc-finger double domain
251-273 C2H2-type zinc finger
251-273 Zinc finger, C2H2 type
251-274 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MGSEKEQRPEAHLPEEGEGAKPWRVDGSKDSQITPREDHGQESLLAGLHGTHPPKTRQKV 60
61 TAQAGGPGDPMLFSSPETDEKLFICAQCGKTFNNTSNLRTHQRIHTGEKPYKCSECGKSF 120
121 SRSSNRIRHERIHLEEKHYQCAKCQESFRRRSDLTTHQQDHLGQRPYRCDICGKSFTQSS 180
181 TLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFGA 240
241 HQRTHRGEKPYRCTLCGKHFSRSSNLIRHQKTHLGEQDEKDFS
Interface Residues: 93, 94, 95, 96, 97, 99, 100, 101, 102, 103, 104, 106, 122, 123, 124, 125, 126, 128, 129, 131, 132, 149, 150, 151, 152, 153, 156, 158, 177, 178, 179, 180, 181, 184, 195, 205, 206, 207, 208, 209, 211, 212, 233, 234, 235, 236, 237, 238, 239, 240, 243, 244, 261, 262, 263, 264, 265, 267, 268, 274
3D-footprint Homologues: 3uk3_C, 7w1m_H, 1tf3_A, 5k5i_A, 1llm_D, 5v3j_F, 8ssq_A, 8ssu_A, 5kkq_D, 1tf6_A, 8gn3_A, 4m9v_C, 2lt7_A, 6e94_A, 2jpa_A, 2wbs_A, 5yj3_D, 5yel_A, 6ml4_A, 2gli_A, 6jnm_A, 7txc_E, 5ei9_F, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 8cuc_F, 7n5w_A, 5kl3_A, 6blw_A, 6u9q_A, 4x9j_A, 1g2f_F, 8h9h_G, 7y3m_I, 7y3l_A, 2drp_D, 5k5l_F, 1f2i_J
Binding Motifs: PB0099.1 ydhacAGTGCTCmywrw
PB0203.1 kacgwGACTCCyywmms
Publications: Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.