Transcription Factor
Accessions: | Q3TDE8 (JASPAR 2024) |
Names: | ZN691_MOUSE |
Organisms: | Mus musculus |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 283 |
Pfam Domains: | 82-103 C2H2-type zinc finger 83-105 C2H2-type zinc finger 83-105 Zinc finger, C2H2 type 97-122 Zinc-finger double domain 110-122 C2H2-type zinc finger 111-133 C2H2-type zinc finger 111-133 Zinc finger, C2H2 type 128-149 Zinc-finger double domain 139-161 C2H2-type zinc finger 139-161 C2H2-type zinc finger 139-161 Zinc finger, C2H2 type 153-178 Zinc-finger double domain 167-189 Zinc finger, C2H2 type 167-179 C2H2-type zinc finger 167-189 C2H2-type zinc finger 182-206 Zinc-finger double domain 195-217 Zinc finger, C2H2 type 195-217 C2H2-type zinc finger 195-217 C2H2-type zinc finger 213-233 Zinc-finger double domain 222-247 C2H2-type zinc finger 223-245 Zinc finger, C2H2 type 223-245 C2H2-type zinc finger 240-261 Zinc-finger double domain 251-273 C2H2-type zinc finger 251-273 Zinc finger, C2H2 type 251-274 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 MGSEKEQRPEAHLPEEGEGAKPWRVDGSKDSQITPREDHGQESLLAGLHGTHPPKTRQKV 60 61 TAQAGGPGDPMLFSSPETDEKLFICAQCGKTFNNTSNLRTHQRIHTGEKPYKCSECGKSF 120 121 SRSSNRIRHERIHLEEKHYQCAKCQESFRRRSDLTTHQQDHLGQRPYRCDICGKSFTQSS 180 181 TLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFGA 240 241 HQRTHRGEKPYRCTLCGKHFSRSSNLIRHQKTHLGEQDEKDFS |
Interface Residues: | 93, 94, 95, 96, 97, 99, 100, 101, 102, 103, 104, 106, 122, 123, 124, 125, 126, 128, 129, 131, 132, 149, 150, 151, 152, 153, 156, 158, 177, 178, 179, 180, 181, 184, 195, 205, 206, 207, 208, 209, 211, 212, 233, 234, 235, 236, 237, 238, 239, 240, 243, 244, 261, 262, 263, 264, 265, 267, 268, 274 |
3D-footprint Homologues: | 3uk3_C, 1tf3_A, 7w1m_H, 8ssu_A, 1tf6_A, 5v3j_F, 8gn3_A, 1llm_D, 5kkq_D, 5k5i_A, 8ssq_A, 4m9v_C, 2lt7_A, 6e94_A, 2jpa_A, 2i13_A, 2wbs_A, 5yj3_D, 5und_A, 5yel_A, 6ml4_A, 6wmi_A, 2gli_A, 6jnm_A, 5ei9_F, 7txc_E, 7eyi_G, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 7n5w_A, 8cuc_F, 4x9j_A, 6blw_A, 6u9q_A, 1mey_C, 5kl3_A, 1g2f_F, 8h9h_G, 7y3m_I, 7y3l_A, 5k5l_F, 2drp_D, 1f2i_J |
Binding Motifs: | PB0099.1 ydhacAGTGCTCmywrw PB0203.1 kacgwGACTCCyywmms |
Publications: | Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.