Transcription Factor
| Accessions: | 4u0y_D (3D-footprint 20250804) |
| Names: | HTH-type transcriptional repressor NagR, HTH-type transcriptional repressor YvoA, N-acetylglucosamine utilization regulator, NAGR_BACSU |
| Organisms: | Bacillus subtilis, strain 168 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O34817 |
| Length: | 74 |
| Pfam Domains: | 11-73 Bacterial regulatory proteins, gntR family 38-72 DeoR-like helix-turn-helix domain |
| Sequence: (in bold interface residues) | 1 NINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNE 60 61 GLLYRLKGRGTFVS |
| Interface Residues: | 11, 28, 35, 36, 37, 40, 46, 47, 48, 49, 50, 51, 52, 55, 67, 68 |
| 3D-footprint Homologues: | 7zla_B, 8jpx_A, 8jsi_A, 6wg7_G, 4h0e_A, 4wwc_B, 4p9u_F, 4u0y_B, 1h9t_B, 6za3_B, 4i2o_B, 3wgi_D |
| Binding Motifs: | 4u0y_ABCD GTGGycTAgaCCAC |
| Binding Sites: | 4u0y_E / 4u0y_F |
| Publications: | Fillenberg S.B, Grau F.C, Seidel G, Muller Y.A. Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR. Nucleic acids research 43:1283-96 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.