Transcription Factor

Accessions: 4u0y_D (3D-footprint 20260701)
Names: HTH-type transcriptional repressor NagR, HTH-type transcriptional repressor YvoA, N-acetylglucosamine utilization regulator, NAGR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O34817
Length: 74
Pfam Domains: 11-73 Bacterial regulatory proteins, gntR family
38-72 DeoR-like helix-turn-helix domain
Sequence:
(in bold interface residues)
1 NINKQSPIPIYYQIMEQLKTQIKNGELQPDMPLPSEREYAEQFGISRMTVRQALSNLVNE 60
61 GLLYRLKGRGTFVS
Interface Residues: 11, 28, 35, 36, 37, 40, 46, 47, 48, 49, 50, 51, 52, 55, 67, 68
3D-footprint Homologues: 7zla_B, 8jpx_A, 8jsi_A, 6wg7_G, 4p9u_F, 4h0e_A, 4wwc_B, 1h9t_B, 6za3_B, 4u0y_B, 4i2o_B, 3wgi_D
Binding Motifs: 4u0y_ABCD GTGGycTAgaCCAC
Binding Sites: 4u0y_E / 4u0y_F
Publications: Fillenberg S.B, Grau F.C, Seidel G, Muller Y.A. Structural insight into operator dre-sites recognition and effector binding in the GntR/HutC transcription regulator NagR. Nucleic acids research 43:1283-96 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.