Transcription Factor
| Accessions: | 1o4x_A (3D-footprint 20260701) |
| Names: | NF-A1, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1, transcription factor Oct-1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P14859 |
| Length: | 129 |
| Pfam Domains: | 2-75 Pou domain - N-terminal to homeobox domain 82-127 Homeobox domain |
| Sequence: (in bold interface residues) | 1 EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM 60 61 AKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCN 120 121 RRQKEKRIN |
| Interface Residues: | 27, 43, 44, 45, 46, 48, 49, 55, 59, 76, 78, 79, 82, 83, 112, 113, 115, 116, 119, 120, 122, 123, 124, 127 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 8bx1_A, 7xzx_N, 3q05_B, 7xzz_N, 1o4x_A, 8g87_X, 1e3o_C, 1au7_A, 2xsd_C, 7xrc_C, 1lq1_D, 2ld5_A, 5jlw_D, 8ik5_C, 8osb_E, 1ig7_A, 7q3o_C, 1le8_A, 5hod_A, 3lnq_A, 8ejp_B, 1b72_A, 7psx_B, 4qtr_D, 3a01_E, 1zq3_P, 2lkx_A, 1nk2_P, 8eml_B, 1du0_A, 4xrs_G, 3cmy_A, 2d5v_B, 8pmf_A, 1jgg_B, 5zjt_E, 3rkq_B, 2r5y_A, 5flv_I, 2hdd_A, 9b8u_A, 6es3_K, 4cyc_A, 1puf_A, 1fjl_B |
| Binding Motifs: | 1o4x_AB CATTnGCATGACAAAG |
| Publications: | Williams D.C, Cai M, Clore G.M. Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex. The Journal of biological chemistry 279:1449-57 (2004). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.