Transcription Factor
| Accessions: | 5vmx_A (3D-footprint 20231221) |
| Names: | KAISO_HUMAN, Transcriptional regulator Kaiso, Zinc finger and BTB domain-containing protein 33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 122 |
| Pfam Domains: | 28-51 Zinc-finger double domain 42-64 C2H2-type zinc finger 58-80 Zinc-finger double domain 70-93 Zinc finger, C2H2 type 70-93 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH 60 61 EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL 120 121 SD |
| Interface Residues: | 14, 24, 25, 26, 27, 28, 30, 31, 33, 34, 37, 52, 53, 54, 55, 56, 57, 58, 59, 60, 80, 81, 82, 83, 84, 85, 86, 87, 88, 91, 115, 117 |
| 3D-footprint Homologues: | 2kmk_A, 6jnm_A, 1tf3_A, 6ml4_A, 7n5w_A, 1mey_C, 7w1m_H, 5und_A, 2drp_D, 7eyi_G, 5k5i_A, 8ssu_A, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 4x9j_A, 2i13_A, 6e94_A, 5kl3_A, 1ubd_C, 7ysf_A, 6wmi_A, 5ei9_F, 8ssq_A, 5v3j_F, 8h9h_G, 2lt7_A, 6a57_A, 8gn3_A, 2jpa_A, 3uk3_C, 8cuc_F, 7y3l_A, 1f2i_J, 6u9q_A, 5yel_A, 1llm_D, 7txc_E, 2wbs_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | 5vmx_A GnnTCCCGCGA |
| Binding Sites: | 5vmx_D 5vmx_E |
| Publications: | Nikolova EN, Stanfield RL, Dyson HJ, Wright PE. CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso. Biochemistry 57:2109-2120 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.